Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CDAN1 monoclonal antibody (M01), clone 7A10. Western Blot analysis of CDAN1 expression in K-562.)

Mouse CDAN1 Monoclonal Antibody | anti-CDAN1 antibody

CDAN1 (Congenital dyserythropoietic Anemia, Type I, CDA-I, CDA1, CDAI, DLT, PRO1295, codanin) (AP)

Gene Names
CDAN1; DLT; CDA1; CDAI; PRO1295
Applications
Western Blot
Purity
Purified
Synonyms
CDAN1; Monoclonal Antibody; CDAN1 (Congenital dyserythropoietic Anemia; Type I; CDA-I; CDA1; CDAI; DLT; PRO1295; codanin) (AP); Congenital dyserythropoietic Anemia; codanin; anti-CDAN1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
7A10
Specificity
Recognizes CDAN1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CDAN1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CDAN1 (NP_612486.2, 1130aa-1227aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PLQLLLSPRNVGLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSLHQAQWPGDFAEELATLSNLFLAEPHLPEPQLRACELVQPNRGTVLAQS
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CDAN1 monoclonal antibody (M01), clone 7A10. Western Blot analysis of CDAN1 expression in K-562.)

Western Blot (WB) (CDAN1 monoclonal antibody (M01), clone 7A10. Western Blot analysis of CDAN1 expression in K-562.)

Testing Data

(Detection limit for recombinant GST tagged CDAN1 is 1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CDAN1 is 1 ng/ml as a capture antibody.)
Related Product Information for anti-CDAN1 antibody
This gene encodes a protein that appears to play a role in nuclear envelope integrity, possibly related to microtubule attachments. Mutations in this gene cause congenital dyserythropoietic anemia type I, a disease resulting in morphological and functional abnormalities of erythropoiesis. [provided by RefSeq]
Product Categories/Family for anti-CDAN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
134,120 Da
NCBI Official Full Name
codanin-1
NCBI Official Synonym Full Names
codanin 1
NCBI Official Symbol
CDAN1
NCBI Official Synonym Symbols
DLT; CDA1; CDAI; PRO1295
NCBI Protein Information
codanin-1; discs lost homolog; congenital dyserythropoietic anemia, type I
UniProt Protein Name
Codanin-1
Protein Family
UniProt Gene Name
CDAN1
UniProt Entry Name
CDAN1_HUMAN

Similar Products

Product Notes

The CDAN1 cdan1 (Catalog #AAA6165720) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CDAN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDAN1 cdan1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDAN1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.