Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using FMNL1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Rabbit anti-Human, Mouse FMNL1 Polyclonal Antibody | anti-FMNL1 antibody
FMNL1 Polyclonal Antibody
Gene Names
FMNL1; FMNL; FHOD4; KW-13; C17orf1; C17orf1B
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
FMNL1; Polyclonal Antibody; FMNL1 Polyclonal Antibody; C17orf1; C17orf1B; FHOD4; FMNL; KW-13; anti-FMNL1 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
DLHFLDKAGSVSLDSVLADVRSLQRGLELTQREFVRQDDCMVLKEFLRANSPTMDKLLADSKTAQEAFESVVEYFGENPKTTSPGLFFSLFSRFIKAYKKAEQEVEQWKKEAAAQEAGADTPGKGEPPAPKSPPKARRPQMDLISELKRRQQKEPLIYESDRDGAIEDIIT
Sequence Length
1100
Applicable Applications for anti-FMNL1 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human FMNL1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Cell projection, Cytoplasm, Cytoplasmic vesicle, Lipid-anchor, bleb, cell cortex, phagosome
Positive Samples
LO2, A-549, Mouse brain
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using FMNL1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using FMNL1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-FMNL1 antibody
This gene encodes a formin-related protein. Formin-related proteins have been implicated in morphogenesis, cytokinesis, and cell polarity. An alternative splice variant has been described but its full length sequence has not been determined.
Product Categories/Family for anti-FMNL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 121kDa; 122kDa; 128kDa
Observed: 150kDa
Observed: 150kDa
NCBI Official Full Name
formin-like protein 1
NCBI Official Synonym Full Names
formin like 1
NCBI Official Symbol
FMNL1
NCBI Official Synonym Symbols
FMNL; FHOD4; KW-13; C17orf1; C17orf1B
NCBI Protein Information
formin-like protein 1
UniProt Protein Name
Formin-like protein 1
UniProt Gene Name
FMNL1
UniProt Synonym Gene Names
C17orf1; C17orf1B; FMNL; FRL1
NCBI Description
This gene encodes a formin-related protein. Formin-related proteins have been implicated in morphogenesis, cytokinesis, and cell polarity. An alternative splice variant has been described but its full length sequence has not been determined. [provided by RefSeq, Jul 2008]
Uniprot Description
May play a role in the control of cell motility and survival of macrophages (). Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the cortical actin filament dynamics and cell shape.
Research Articles on FMNL1
Similar Products
Product Notes
The FMNL1 fmnl1 (Catalog #AAA9133059) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FMNL1 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's FMNL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the FMNL1 fmnl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DLHFLDKAGS VSLDSVLADV RSLQRGLELT QREFVRQDDC MVLKEFLRAN SPTMDKLLAD SKTAQEAFES VVEYFGENPK TTSPGLFFSL FSRFIKAYKK AEQEVEQWKK EAAAQEAGAD TPGKGEPPAP KSPPKARRPQ MDLISELKRR QQKEPLIYES DRDGAIEDII T. It is sometimes possible for the material contained within the vial of "FMNL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
