Mouse anti-Human CD48 Monoclonal Antibody | anti-CD48 antibody

CD48 (CD48 Antigen, B-lymphocyte Activation Marker BLAST-1, BCM1 Surface Antigen, Leukocyte Antigen MEM-102, TCT.1, BCM1, BLAST1) (Biotin)

Cat. Num. AAA6141068

• Gene Names: CD48; BCM1; BLAST; hCD48; mCD48; BLAST1; SLAMF2; MEM-102
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD48; Monoclonal Antibody; CD48 (CD48 Antigen; B-lymphocyte Activation Marker BLAST-1; BCM1 Surface Antigen; Leukocyte Antigen MEM-102; TCT.1; BCM1; BLAST1) (Biotin); anti-CD48 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B8-2C2
• Specificity: Recognizes human CD48.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CD48 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 2ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-169 from human CD48 (AAH30224) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLGESGEPKSKSPLQWPQMDHCRASWEAWGTLGEEERKTSGQV
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (44.33kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CD48 on formalin-fixed paraffin-embedded human tonsil tissue.[antibody concentration 2ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CD48 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-CD48 antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 20988821
• NCBI GeneID: 962
• Molecular Weight: 19,429 Da
• NCBI Official Full Name: Homo sapiens CD48 molecule, mRNA
• NCBI Official Synonym Full Names: CD48 molecule
• NCBI Official Symbol: CD48
• NCBI Official Synonym Symbols: BCM1; BLAST; hCD48; mCD48; BLAST1; SLAMF2; MEM-102
• NCBI Protein Information: CD48 antigen
• Protein Family: CD48 antigen

NCBI Description

This gene encodes a member of the CD2 subfamily of immunoglobulin-like receptors which includes SLAM (signaling lymphocyte activation molecules) proteins. The encoded protein is found on the surface of lymphocytes and other immune cells, dendritic cells and endothelial cells, and participates in activation and differentiation pathways in these cells. The encoded protein does not have a transmembrane domain, however, but is held at the cell surface by a GPI anchor via a C-terminal domain which maybe cleaved to yield a soluble form of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]