Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CD46 is ~1ng/ml as a capture antibody.)

Mouse anti-Human CD46 Monoclonal Antibody | anti-CD46 antibody

CD46 (Membrane Cofactor Protein, TLX, Trophoblast Leukocyte Common Antigen, MCP, MIC10, MGC26544) (FITC)

Gene Names
CD46; MCP; TLX; AHUS2; MIC10; TRA2.10
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD46; Monoclonal Antibody; CD46 (Membrane Cofactor Protein; TLX; Trophoblast Leukocyte Common Antigen; MCP; MIC10; MGC26544) (FITC); anti-CD46 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E10
Specificity
Recognizes human CD46.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CD46 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa36-135 from human CD46 (AAH30594) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIG
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CD46 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CD46 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-CD46 antibody
CD46, also known as MCP (complement membrane cofactor protein), is a type I membrane protein that has cofactor activity for inactivation of complement components C3b and C4b by serum factor I. CD46 is widely distributed in leukocytes, platelets, epithelial cells, and fibroblasts. At least fourteen different transcript variants encoding different isoforms have been reported for this gene.
Product Categories/Family for anti-CD46 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
36,826 Da
NCBI Official Full Name
Homo sapiens CD46 molecule, complement regulatory protein, mRNA
NCBI Official Synonym Full Names
CD46 molecule
NCBI Official Symbol
CD46
NCBI Official Synonym Symbols
MCP; TLX; AHUS2; MIC10; TRA2.10
NCBI Protein Information
membrane cofactor protein
Protein Family

NCBI Description

The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. The encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations at this locus have been associated with susceptibility to hemolytic uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2010]

Research Articles on CD46

Similar Products

Product Notes

The CD46 (Catalog #AAA6146370) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD46 (Membrane Cofactor Protein, TLX, Trophoblast Leukocyte Common Antigen, MCP, MIC10, MGC26544) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD46 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD46 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD46, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.