Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CD40LG is ~0.3ng/ml using as a capture antibody.)

Mouse anti-Human CD40LG Monoclonal Antibody | anti-CD40LG antibody

CD40LG (CD40 Ligand, CD40-L, T-cell Antigen Gp39, TNF-related Activation Protein, TRAP, Tumor Necrosis Factor Ligand Superfamily Member 5, CD154, CD40L, TNFSF5, TRAP) (MaxLight 490)

Gene Names
CD40LG; IGM; IMD3; TRAP; gp39; CD154; CD40L; HIGM1; T-BAM; TNFSF5; hCD40L
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD40LG; Monoclonal Antibody; CD40LG (CD40 Ligand; CD40-L; T-cell Antigen Gp39; TNF-related Activation Protein; TRAP; Tumor Necrosis Factor Ligand Superfamily Member 5; CD154; CD40L; TNFSF5; TRAP) (MaxLight 490); anti-CD40LG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2E2
Specificity
Recognizes human CD40LG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-CD40LG antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa101-203 from human CD40LG with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NKEETKKENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQAPFIASLCLKSPGRFER
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CD40LG is ~0.3ng/ml using as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CD40LG is ~0.3ng/ml using as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of CD40LG expression in K-562 using.)

Western Blot (WB) (Western Blot analysis of CD40LG expression in K-562 using.)
Related Product Information for anti-CD40LG antibody
Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL-4. Involved in immunoglobulin class switching. Release of soluble CD40L from platelets is partially regulated by GP IIb/IIIa, actin polymerization, and an matrix metalloproteinases (MMP) inhibitor-sensitive pathway.
Product Categories/Family for anti-CD40LG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
959
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18.3 kDa (169aa), confirmed by MALDI-TOF
NCBI Official Full Name
CD40 ligand
NCBI Official Synonym Full Names
CD40 ligand
NCBI Official Symbol
CD40LG
NCBI Official Synonym Symbols
IGM; IMD3; TRAP; gp39; CD154; CD40L; HIGM1; T-BAM; TNFSF5; hCD40L
NCBI Protein Information
CD40 ligand
UniProt Protein Name
CD40 ligand
Protein Family
UniProt Gene Name
CD40LG
UniProt Synonym Gene Names
CD40L; TNFSF5; TRAP; CD40-L; TRAP
UniProt Entry Name
CD40L_HUMAN

NCBI Description

The protein encoded by this gene is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome. [provided by RefSeq, Jul 2008]

Uniprot Description

CD40LG: Mediates B-cell proliferation in the absence of co- stimulus as well as IgE production in the presence of IL-4. Involved in immunoglobulin class switching. Defects in CD40LG are the cause of X-linked immunodeficiency with hyper-IgM type 1 (HIGM1); also known as X-linked hyper IgM syndrome (XHIM). HIGM1 is an immunoglobulin isotype switch defect characterized by elevated concentrations of serum IgM and decreased amounts of all other isotypes. Affected males present at an early age (usually within the first year of life) recurrent bacterial and opportunistic infections, including Pneumocystis carinii pneumonia and intractable diarrhea due to cryptosporidium infection. Despite substitution treatment with intravenous immunoglobulin, the overall prognosis is rather poor, with a death rate of about 10% before adolescence. Belongs to the tumor necrosis factor family.

Protein type: Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: Xq26

Cellular Component: extracellular space; integral to plasma membrane; integral to membrane; plasma membrane; external side of plasma membrane

Molecular Function: CD40 receptor binding; cytokine activity; tumor necrosis factor receptor binding

Biological Process: B cell proliferation; platelet activation; leukocyte adhesion; regulation of immune response; positive regulation of interleukin-12 production; immunoglobulin secretion; B cell differentiation; isotype switching; inflammatory response; regulation of immunoglobulin secretion; negative regulation of apoptosis

Disease: Immunodeficiency With Hyper-igm, Type 1

Research Articles on CD40LG

Similar Products

Product Notes

The CD40LG cd40lg (Catalog #AAA6199996) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD40LG (CD40 Ligand, CD40-L, T-cell Antigen Gp39, TNF-related Activation Protein, TRAP, Tumor Necrosis Factor Ligand Superfamily Member 5, CD154, CD40L, TNFSF5, TRAP) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD40LG can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD40LG cd40lg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD40LG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.