Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CD3EAP Monoclonal Antibody | anti-CD3EAP antibody

CD3EAP (DNA-directed RNA Polymerase I Subunit RPA34, A34.5, Antisense to ERCC-1 Protein, ASE-1, CD3-epsilon-associated Protein, CAST, CD3E-associated Protein, RNA Polymerase I-associated Factor PAF49, ASE1, CAST, PAF49) (MaxLight 405)

Gene Names
CD3EAP; ASE1; CAST; ASE-1; PAF49
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD3EAP; Monoclonal Antibody; CD3EAP (DNA-directed RNA Polymerase I Subunit RPA34; A34.5; Antisense to ERCC-1 Protein; ASE-1; CD3-epsilon-associated Protein; CAST; CD3E-associated Protein; RNA Polymerase I-associated Factor PAF49; ASE1; PAF49) (MaxLight 405); anti-CD3EAP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6A6
Specificity
Recognizes human CD3EAP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-CD3EAP antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-110 from human CD3EAP (NP_036231) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASA
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-CD3EAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,172 Da
NCBI Official Full Name
DNA-directed RNA polymerase I subunit RPA34 isoform 2
NCBI Official Synonym Full Names
CD3e molecule, epsilon associated protein
NCBI Official Symbol
CD3EAP
NCBI Official Synonym Symbols
ASE1; CAST; ASE-1; PAF49
NCBI Protein Information
DNA-directed RNA polymerase I subunit RPA34; CD3e antigen, epsilon polypeptide associated protein; RNA polymerase I-associated factor PAF49; antisense to ERCC-1 protein
UniProt Protein Name
DNA-directed RNA polymerase I subunit RPA34
UniProt Gene Name
CD3EAP
UniProt Synonym Gene Names
ASE1; CAST; PAF49; ASE-1; CAST
UniProt Entry Name
RPA34_HUMAN

Uniprot Description

ASE-1: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Isoform 1 is involved in UBTF-activated transcription, presumably at a step following PIC formation. Belongs to the eukaryotic RPA34 RNA polymerase subunit family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; Transcription initiation complex

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: nucleoplasm; mitochondrion; cytoplasm; nucleolus; RNA polymerase I transcription factor complex; chromosome; nucleus; DNA-directed RNA polymerase I complex

Molecular Function: DNA-directed RNA polymerase activity

Biological Process: negative regulation of gene expression, epigenetic; RNA elongation from RNA polymerase I promoter; transcription from RNA polymerase I promoter; gene expression; transcription initiation from RNA polymerase I promoter; termination of RNA polymerase I transcription; regulation of gene expression, epigenetic; transmembrane receptor protein tyrosine kinase signaling pathway; rRNA transcription

Similar Products

Product Notes

The CD3EAP cd3eap (Catalog #AAA6189318) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD3EAP (DNA-directed RNA Polymerase I Subunit RPA34, A34.5, Antisense to ERCC-1 Protein, ASE-1, CD3-epsilon-associated Protein, CAST, CD3E-associated Protein, RNA Polymerase I-associated Factor PAF49, ASE1, CAST, PAF49) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD3EAP can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD3EAP cd3eap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD3EAP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.