Mouse anti-Human CD3EAP Monoclonal Antibody | anti-CD3EAP antibody

CD3EAP (DNA-directed RNA Polymerase I Subunit RPA34, A34.5, Antisense to ERCC-1 Protein, ASE-1, CD3-epsilon-associated Protein, CAST, CD3E-associated Protein, RNA Polymerase I-associated Factor PAF49, ASE1, CAST, PAF49) (AP)

Cat. Num. AAA6130455

• Gene Names: CD3EAP; ASE1; CAST; ASE-1; PAF49
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD3EAP; Monoclonal Antibody; CD3EAP (DNA-directed RNA Polymerase I Subunit RPA34; A34.5; Antisense to ERCC-1 Protein; ASE-1; CD3-epsilon-associated Protein; CAST; CD3E-associated Protein; RNA Polymerase I-associated Factor PAF49; ASE1; PAF49) (AP); anti-CD3EAP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6A6
• Specificity: Recognizes human CD3EAP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-CD3EAP antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa2-110 from human CD3EAP (NP_036231) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASA
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CD3EAP on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CD3EAP is 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-CD3EAP antibody

Antibodies; RNA Processing

NCBI and Uniprot Product Information

• NCBI GI #: 6912246
• NCBI GeneID: 10849
• NCBI Accession #: NP_036231
• NCBI GenBank Nucleotide #: NM_012099
• UniProt Accession #: O15446; Q32N11; Q7Z5U2; Q9UPF6
• Molecular Weight: 55,172 Da
• NCBI Official Full Name: DNA-directed RNA polymerase I subunit RPA34 isoform 2
• NCBI Official Synonym Full Names: CD3e molecule, epsilon associated protein
• NCBI Official Symbol: CD3EAP
• NCBI Official Synonym Symbols: ASE1; CAST; ASE-1; PAF49
• NCBI Protein Information: DNA-directed RNA polymerase I subunit RPA34; CD3e antigen, epsilon polypeptide associated protein; RNA polymerase I-associated factor PAF49; antisense to ERCC-1 protein
• UniProt Protein Name: DNA-directed RNA polymerase I subunit RPA34
• UniProt Gene Name: CD3EAP
• UniProt Synonym Gene Names: ASE1; CAST; PAF49; ASE-1; CAST
• UniProt Entry Name: RPA34_HUMAN

Uniprot Description

ASE-1: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Isoform 1 is involved in UBTF-activated transcription, presumably at a step following PIC formation. Belongs to the eukaryotic RPA34 RNA polymerase subunit family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; Transcription initiation complex

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: nucleoplasm; mitochondrion; cytoplasm; nucleolus; RNA polymerase I transcription factor complex; chromosome; nucleus; DNA-directed RNA polymerase I complex

Molecular Function: DNA-directed RNA polymerase activity

Biological Process: negative regulation of gene expression, epigenetic; RNA elongation from RNA polymerase I promoter; transcription from RNA polymerase I promoter; gene expression; transcription initiation from RNA polymerase I promoter; termination of RNA polymerase I transcription; regulation of gene expression, epigenetic; transmembrane receptor protein tyrosine kinase signaling pathway; rRNA transcription