Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (46.09kD).)

Mouse anti-Human CD3E Monoclonal Antibody | anti-CD3E antibody

CD3E (T-cell Surface Glycoprotein CD3 epsilon Chain, T-cell Surface Antigen T3/Leu-4 epsilon Chain, T3E, CD3e) (Biotin)

Gene Names
CD3E; T3E; TCRE; IMD18
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD3E; Monoclonal Antibody; CD3E (T-cell Surface Glycoprotein CD3 epsilon Chain; T-cell Surface Antigen T3/Leu-4 epsilon Chain; T3E; CD3e) (Biotin); anti-CD3E antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C1
Specificity
Recognizes human CD3E.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CD3E antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa23-207 from human CD3E (AAH49847.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (46.09kD).)

Western Blot (WB) (Western Blot detection against Immunogen (46.09kD).)

Western Blot (WB)

(CD3E monoclonal antibody Western Blot analysis of CD3E expression in HeLa.)

Western Blot (WB) (CD3E monoclonal antibody Western Blot analysis of CD3E expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged CD3E is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CD3E is ~1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CD247 and CD3E. HeLa cells were stained with CD247 rabbit purified polyclonal 1:1200 and CD3E mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CD247 and CD3E. HeLa cells were stained with CD247 rabbit purified polyclonal 1:1200 and CD3E mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-CD3E antibody
T cell activation through the T cell antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits CD3g, CD3d, CD3e and CD3Xi. These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine-based motif present in a single copy in the CD3 subunits. CD3e may play a role in TCR-induced growth arrest, cell survival and proliferation.
Product Categories/Family for anti-CD3E antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
916
Molecular Weight
23,147 Da
NCBI Official Full Name
Homo sapiens CD3e molecule, epsilon (CD3-TCR complex), mRNA
NCBI Official Synonym Full Names
CD3e molecule
NCBI Official Symbol
CD3E
NCBI Official Synonym Symbols
T3E; TCRE; IMD18
NCBI Protein Information
T-cell surface glycoprotein CD3 epsilon chain

NCBI Description

The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. [provided by RefSeq, Jul 2008]

Research Articles on CD3E

Similar Products

Product Notes

The CD3E (Catalog #AAA6141060) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD3E (T-cell Surface Glycoprotein CD3 epsilon Chain, T-cell Surface Antigen T3/Leu-4 epsilon Chain, T3E, CD3e) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD3E can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD3E for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD3E, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.