Mouse CD19 Monoclonal Antibody | anti-CD19 antibody

CD19 (CD19 Molecule, B4, MGC12802) (HRP)

Cat. Num. AAA6181255

• Gene Names: CD19; B4; CVID3
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified
• Synonyms: CD19; Monoclonal Antibody; CD19 (CD19 Molecule; B4; MGC12802) (HRP); CD19 Molecule; MGC12802; anti-CD19 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1G3
• Specificity: Recognizes CD19.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-CD19 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: CD19 (NP_001761, 98aa-187aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CD19 expression in transfected 293T cell line by CD19 monoclonal antibody (M01), clone 1G3.Lane 1: CD19 transfected lysate (61.1 KDa).Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of CD19 transfected lysate using anti-CD19 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CD19 MaxPab rabbit polyclonal antibody.)

Product Categories/Family for anti-CD19 antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 91105174
• NCBI GeneID: 930
• NCBI Accession #: NP_001761
• NCBI GenBank Nucleotide #: NM_001770
• UniProt Accession #: P15391; Q96S68; Q9BRD6; A0N0P9; F5H635
• Molecular Weight: 61,200 Da
• NCBI Official Full Name: B-lymphocyte antigen CD19 isoform 2
• NCBI Official Synonym Full Names: CD19 molecule
• NCBI Official Symbol: CD19
• NCBI Official Synonym Symbols: B4; CVID3
• NCBI Protein Information: B-lymphocyte antigen CD19; B-lymphocyte surface antigen B4; T-cell surface antigen Leu-12; differentiation antigen CD19
• UniProt Protein Name: B-lymphocyte antigen CD19
• Protein Family: B-lymphocyte antigen
• UniProt Gene Name: CD19
• UniProt Entry Name: CD19_HUMAN

Uniprot Description

CD19: a cell surface molecule which assembles with the antigen receptor of B lymphocytes. A critical signal transduction molecule that regulates B lymphocyte development, activation, and differentiation. Ligation increases intracellular calcium levels and decreases the threshold for antigen receptor signaling. Germinal center formation is significantly reduced in CD19-deficient mice.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: protein complex; integral to plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: receptor signaling protein activity

Biological Process: epidermal growth factor receptor signaling pathway; B cell receptor signaling pathway; regulation of immune response; cell surface receptor linked signal transduction; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; nerve growth factor receptor signaling pathway; cellular defense response; innate immune response; positive regulation of release of sequestered calcium ion into cytosol

Disease: Immunodeficiency, Common Variable, 2; Immunodeficiency, Common Variable, 3