Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen using (37kD).)

Mouse anti-Human CD177 Monoclonal Antibody | anti-CD177 antibody

CD177 (CD177 Antigen, Human Neutrophil Alloantigen 2a, HNA-2a, NB1 Glycoprotein, NB1 GP, PRV-1, Polycythemia Rubra Vera Protein 1, NB1, PRV1, UNQ595/PRO1181) (AP)

Gene Names
CD177; NB1; PRV1; HNA2A; PRV-1; HNA-2a; NB1 GP
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD177; Monoclonal Antibody; CD177 (CD177 Antigen; Human Neutrophil Alloantigen 2a; HNA-2a; NB1 Glycoprotein; NB1 GP; PRV-1; Polycythemia Rubra Vera Protein 1; NB1; PRV1; UNQ595/PRO1181) (AP); anti-CD177 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C4
Specificity
Recognizes human CD177.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CD177 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa21-120 from human CD177 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ALLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLW
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen using (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen using (37kD).)

Western Blot (WB)

(Western Blot analysis of CD177 expression in transfected 293T cell line using. Lane 1: CD177 transfected lysate (46.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CD177 expression in transfected 293T cell line using. Lane 1: CD177 transfected lysate (46.4kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunohistochemistry of formalin-fixed paraffin-embedded human lymph node using (3ug/ml).)

Immunohistochemistry (IHC) (Immunohistochemistry of formalin-fixed paraffin-embedded human lymph node using (3ug/ml).)

Immunoprecipitation (IP)

(Immunoprecipitation of CD177 transfected lysate using and Protein A Magnetic Bead and immunoblotted with CD177 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of CD177 transfected lysate using and Protein A Magnetic Bead and immunoblotted with CD177 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged CD177 is ~3ng/ml using as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CD177 is ~3ng/ml using as a capture antibody.)
Product Categories/Family for anti-CD177 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
15,683 Da
NCBI Official Full Name
Homo sapiens CD177 molecule, mRNA
NCBI Official Synonym Full Names
CD177 molecule
NCBI Official Symbol
CD177
NCBI Official Synonym Symbols
NB1; PRV1; HNA2A; PRV-1; HNA-2a; NB1 GP
NCBI Protein Information
CD177 antigen
Protein Family

NCBI Description

This gene encodes a glycosyl-phosphatidylinositol (GPI)-linked cell surface glycoprotein that plays a role in neutrophil activation. The protein can bind platelet endothelial cell adhesion molecule-1 and function in neutrophil transmigration. Mutations in this gene are associated with myeloproliferative diseases. Over-expression of this gene has been found in patients with polycythemia rubra vera. Autoantibodies against the protein may result in pulmonary transfusion reactions, and it may be involved in Wegener's granulomatosis. A related pseudogene, which is adjacent to this gene on chromosome 19, has been identified. [provided by RefSeq, Apr 2014]

Research Articles on CD177

Similar Products

Product Notes

The CD177 (Catalog #AAA6130429) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD177 (CD177 Antigen, Human Neutrophil Alloantigen 2a, HNA-2a, NB1 Glycoprotein, NB1 GP, PRV-1, Polycythemia Rubra Vera Protein 1, NB1, PRV1, UNQ595/PRO1181) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD177 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD177 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD177, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.