Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human CCNDBP1 Monoclonal Antibody | anti-CCNDBP1 antibody

CCNDBP1 (Cyclin-D1-binding Protein 1, Grap2 and Cyclin-D-interacting Protein, Human Homolog of Maid, DIP1, GCIP, HHM) (PE)

Gene Names
CCNDBP1; HHM; DIP1; GCIP
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CCNDBP1; Monoclonal Antibody; CCNDBP1 (Cyclin-D1-binding Protein 1; Grap2 and Cyclin-D-interacting Protein; Human Homolog of Maid; DIP1; GCIP; HHM) (PE); anti-CCNDBP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B7
Specificity
Recognizes human CCNDBP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CCNDBP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa261-361 from CCNDBP1 (NP_036274) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LVAENGKKDQVAQMADIVDISDEISPSVDDLALSIYPPMCHLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQSELEL*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of CCNDBP1 expression in transfected 293T cell line by CCNDBP1 monoclonal antibody. Lane 1: CCNDBP1 transfected lysate (40.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CCNDBP1 expression in transfected 293T cell line by CCNDBP1 monoclonal antibody. Lane 1: CCNDBP1 transfected lysate (40.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CCNDBP1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CCNDBP1 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-CCNDBP1 antibody
May negatively regulate cell cycle progression. May act at least in part via inhibition of the cyclin-D1/CDK4 complex, thereby preventing phosphorylation of RB1 and blocking E2F-dependent transcription.
Product Categories/Family for anti-CCNDBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,714 Da
NCBI Official Full Name
cyclin-D1-binding protein 1
NCBI Official Synonym Full Names
cyclin D-type binding-protein 1
NCBI Official Symbol
CCNDBP1
NCBI Official Synonym Symbols
HHM; DIP1; GCIP
NCBI Protein Information
cyclin-D1-binding protein 1; D-type cyclin-interacting protein 1; grap2 and cyclin-D-interacting protein; human homolog of Maid
UniProt Protein Name
Cyclin-D1-binding protein 1
Protein Family
UniProt Gene Name
CCNDBP1
UniProt Synonym Gene Names
DIP1; GCIP; HHM
UniProt Entry Name
CCDB1_HUMAN

Uniprot Description

CCNDBP1: May negatively regulate cell cycle progression. May act at least in part via inhibition of the cyclin-D1/CDK4 complex, thereby preventing phosphorylation of RB1 and blocking E2F- dependent transcription. Belongs to the CCNDBP1 family. 4 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 15q14-q15

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein binding

Biological Process: regulation of cell cycle; cell cycle

Similar Products

Product Notes

The CCNDBP1 ccndbp1 (Catalog #AAA6156921) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CCNDBP1 (Cyclin-D1-binding Protein 1, Grap2 and Cyclin-D-interacting Protein, Human Homolog of Maid, DIP1, GCIP, HHM) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCNDBP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCNDBP1 ccndbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCNDBP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.