Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DDR2Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human, Mouse DDR2 Polyclonal Antibody | anti-DDR2 antibody

DDR2 Antibody - middle region

Gene Names
DDR2; TKT; WRCN; MIG20a; NTRKR3; TYRO10
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
DDR2; Polyclonal Antibody; DDR2 Antibody - middle region; anti-DDR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HGIEFAPMYKINYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPI
Sequence Length
855
Applicable Applications for anti-DDR2 antibody
Western Blot (WB)
Homology
Human 100%, Mouse 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DDR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DDR2Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DDR2Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-DDR2 antibody
Receptor tyrosine kinases (RTKs) play a key role in the communication of cells with their microenvironment. These molecules are involved in the regulation of cell growth, differentiation, and metabolism. In several cases the biochemical mechanism by which RTKs transduce signals across the membrane has been shown to be ligand induced receptor oligomerization and subsequent intracellular phosphorylation. This autophosphorylation leads to phosphorylation of cytosolic targets as well as association with other molecules, which are involved in pleiotropic effects of signal transduction. RTKs have a tripartite structure with extracellular, transmembrane, and cytoplasmic regions. This gene encodes a member of a novel subclass of RTKs and contains a distinct extracellular region encompassing a factor VIII-like domain. Alternative splicing in the 5' UTR results in multiple transcript variants encoding the same protein.
Product Categories/Family for anti-DDR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94 kDa
NCBI Official Full Name
discoidin domain-containing receptor 2
NCBI Official Synonym Full Names
discoidin domain receptor tyrosine kinase 2
NCBI Official Symbol
DDR2
NCBI Official Synonym Symbols
TKT; WRCN; MIG20a; NTRKR3; TYRO10
NCBI Protein Information
discoidin domain-containing receptor 2
UniProt Protein Name
Discoidin domain-containing receptor 2
UniProt Gene Name
DDR2
UniProt Synonym Gene Names
NTRKR3; TKT; TYRO10; Discoidin domain receptor 2
UniProt Entry Name
DDR2_HUMAN

NCBI Description

This gene encodes a member of the discoidin domain receptor subclass of the receptor tyrosine kinase (RTKs) protein family. RTKs play a key role in the communication of cells with their microenvironment. The encoded protein is a collagen-induced receptor that activates signal transduction pathways involved in cell adhesion, proliferation, and extracellular matrix remodeling. This protein is expressed in numerous cell types and may alos be involved in wound repair and regulate tumor growth and invasiveness. Mutations in this gene are the cause of short limb-hand type spondylometaepiphyseal dysplasia. [provided by RefSeq, Aug 2017]

Uniprot Description

DDR2: This tyrosine kinase receptor for fibrillar collagen mediates fibroblast migration and proliferation. Contributes to cutaneous wound healing. Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.

Protein type: Membrane protein, integral; EC 2.7.10.1; Protein kinase, TK; Protein kinase, tyrosine (receptor); Kinase, protein; TK group; DDR family

Chromosomal Location of Human Ortholog: 1q23.3

Cellular Component: focal adhesion; integral to plasma membrane; apical plasma membrane; plasma membrane

Molecular Function: collagen binding; protein binding; transmembrane receptor protein tyrosine kinase activity; ATP binding

Biological Process: extracellular matrix organization and biogenesis; ossification; peptidyl-tyrosine phosphorylation; collagen fibril organization; protein amino acid autophosphorylation; signal transduction; positive regulation of osteoblast differentiation; positive regulation of fibroblast proliferation; biomineral formation; positive regulation of protein kinase activity; positive regulation of transcription factor activity; cell adhesion; regulation of bone mineralization

Disease: Spondylometaepiphyseal Dysplasia, Short Limb-hand Type

Research Articles on DDR2

Similar Products

Product Notes

The DDR2 ddr2 (Catalog #AAA3221363) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDR2 Antibody - middle region reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's DDR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DDR2 ddr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HGIEFAPMYK INYSRDGTRW ISWRNRHGKQ VLDGNSNPYD IFLKDLEPPI. It is sometimes possible for the material contained within the vial of "DDR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.