Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.55kD).)

Mouse anti-Human CBFA2T2 Monoclonal Antibody | anti-CBFA2T2 antibody

CBFA2T2 (EHT, MTGR1, Protein CBFA2T2, ETO Homologous on Chromosome 20, MTG8-like Protein, MTG8-related Protein 1, Myeloid Translocation-related Protein 1, p85) (FITC)

Gene Names
CBFA2T2; EHT; p85; MTGR1; ZMYND3
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CBFA2T2; Monoclonal Antibody; CBFA2T2 (EHT; MTGR1; Protein CBFA2T2; ETO Homologous on Chromosome 20; MTG8-like Protein; MTG8-related Protein 1; Myeloid Translocation-related Protein 1; p85) (FITC); anti-CBFA2T2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2C10
Specificity
Recognizes human CBFA2T2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
7344
Applicable Applications for anti-CBFA2T2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa201-304 from CBFA2T2 (NP_001028171.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LLLNTSIASPADSSELLMEVHGNGKRPSPERREENSFDRDTIAPEPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPNKMLE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.55kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.55kD).)

Western Blot (WB)

(Western Blot analysis of CBFA2T2 expression in transfected 293T cell line by CBFA2T2 monoclonal antibody Lane 1: CBFA2T2 transfected lysate (63.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CBFA2T2 expression in transfected 293T cell line by CBFA2T2 monoclonal antibody Lane 1: CBFA2T2 transfected lysate (63.9kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CBFA2T2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CBFA2T2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml])
Product Categories/Family for anti-CBFA2T2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens CBFA2/RUNX1 partner transcriptional co-repressor 2 (CBFA2T2), transcript variant 3, mRNA
NCBI Official Synonym Full Names
CBFA2/RUNX1 partner transcriptional co-repressor 2
NCBI Official Symbol
CBFA2T2
NCBI Official Synonym Symbols
EHT; p85; MTGR1; ZMYND3
NCBI Protein Information
protein CBFA2T2
Protein Family

NCBI Description

In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 (AML1) gene fused to the 3'-region of the CBFA2T1 (MTG8) gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. The protein encoded by this gene binds to the AML1-MTG8 complex and may be important in promoting leukemogenesis. Several transcript variants are thought to exist for this gene, but the full-length natures of only three have been described. [provided by RefSeq, Jul 2008]

Research Articles on CBFA2T2

Similar Products

Product Notes

The CBFA2T2 (Catalog #AAA6146287) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CBFA2T2 (EHT, MTGR1, Protein CBFA2T2, ETO Homologous on Chromosome 20, MTG8-like Protein, MTG8-related Protein 1, Myeloid Translocation-related Protein 1, p85) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CBFA2T2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CBFA2T2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CBFA2T2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.