Testing Data
(Detection limit for recombinant GST tagged CASQ1 is 1ng/ml as a capture antibody.)
Mouse anti-Human CASQ1 Monoclonal Antibody | anti-CASQ1 antibody
CASQ1 (Calsequestrin-1, Calmitin, Calsequestrin, Skeletal Muscle Isoform, CASQ) (HRP)
Gene Names
CASQ1; CASQ; PDIB1; VMCQA
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CASQ1; Monoclonal Antibody; CASQ1 (Calsequestrin-1; Calmitin; Calsequestrin; Skeletal Muscle Isoform; CASQ) (HRP); anti-CASQ1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1D7
Specificity
Recognizes human CASQ1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CASQ1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa29-130 from human CASQ1 (NP_001222) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QEGLDFPEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGLTEVDSMYVFKGDE
Conjugate
HRP
Preparation and Storage
May be stored at 4 degree C. For long-term storage, aliquot and store at 4 degree C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged CASQ1 is 1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged CASQ1 is 1ng/ml as a capture antibody.)
Related Product Information for anti-CASQ1 antibody
Calsequestrin is a high-capacity, moderate affinity, calcium-binding protein and thus acts as an internal calcium store in muscle. The release of calcium bound to calsequestrin through a calcium release channel triggers muscle contraction. The skeletal muscle CASQ1) binds around 80 Ca2+ ions, while the cardiac CASQ2) binds approximately 60 Ca2+.
Product Categories/Family for anti-CASQ1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
45,160 Da
NCBI Official Full Name
calsequestrin-1
NCBI Official Synonym Full Names
calsequestrin 1 (fast-twitch, skeletal muscle)
NCBI Official Symbol
CASQ1
NCBI Official Synonym Symbols
CASQ; PDIB1; VMCQA
NCBI Protein Information
calsequestrin-1; calmitin; calmitine; calsequestrin, skeletal muscle isoform
Protein Family
Similar Products
Product Notes
The CASQ1 (Catalog #AAA6151585) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CASQ1 (Calsequestrin-1, Calmitin, Calsequestrin, Skeletal Muscle Isoform, CASQ) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CASQ1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CASQ1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CASQ1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
