Mouse anti-Human CAPZB Monoclonal Antibody | anti-CAPZB antibody

CAPZB (F-actin-capping Protein Subunit beta, CapZ beta) APC

Cat. Num. AAA6135664

• Gene Names: CAPZB; CAPB; CAPZ; CAPPB
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CAPZB; Monoclonal Antibody; CAPZB (F-actin-capping Protein Subunit beta; CapZ beta) APC; anti-CAPZB antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1H1
• Specificity: Recognizes human CAPZB.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-CAPZB antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1.5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa192-272 from human CAPZB (NP_004921) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.65kD).)

Western Blot (WB)

(CAPZB monoclonal antibody. Western Blot analysis of CAPZB expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CAPZB on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CAPZB is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-CAPZB antibody

Antibodies; Actin

NCBI and Uniprot Product Information

• NCBI GI #: 4826659
• NCBI GeneID: 832
• NCBI Accession #: NP_004921
• NCBI GenBank Nucleotide #: NM_004930
• Molecular Weight: – Da
• NCBI Official Full Name: F-actin-capping protein subunit beta isoform 1
• NCBI Official Synonym Full Names: capping protein (actin filament) muscle Z-line, beta
• NCBI Official Symbol: CAPZB
• NCBI Official Synonym Symbols: CAPB; CAPZ; CAPPB
• NCBI Protein Information: F-actin-capping protein subunit beta
• Protein Family: F-actin-capping protein

NCBI Description

This gene encodes the beta subunit of the barbed-end actin binding protein, which belongs to the F-actin capping protein family. The capping protein is a heterodimeric actin capping protein that blocks actin filament assembly and disassembly at the fast growing (barbed) filament ends and functions in regulating actin filament dynamics as well as in stabilizing actin filament lengths in muscle and nonmuscle cells. A pseudogene of this gene is located on the long arm of chromosome 2. Multiple alternatively spliced transcript variants encoding different isoforms have been found.[provided by RefSeq, Aug 2013]