Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.65kD).)

Mouse anti-Human CAPZB Monoclonal Antibody | anti-CAPZB antibody

CAPZB (F-actin-capping Protein Subunit beta, CapZ beta) (PE)

Gene Names
CAPZB; CAPB; CAPZ; CAPPB
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CAPZB; Monoclonal Antibody; CAPZB (F-actin-capping Protein Subunit beta; CapZ beta) (PE); anti-CAPZB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H1
Specificity
Recognizes human CAPZB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CAPZB antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa192-272 from human CAPZB (NP_004921) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.65kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.65kD).)

Western Blot (WB)

(CAPZB monoclonal antibody. Western Blot analysis of CAPZB expression in HeLa.)

Western Blot (WB) (CAPZB monoclonal antibody. Western Blot analysis of CAPZB expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CAPZB on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CAPZB on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CAPZB is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CAPZB is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-CAPZB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
832
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
– Da
NCBI Official Full Name
F-actin-capping protein subunit beta isoform 1
NCBI Official Synonym Full Names
capping protein (actin filament) muscle Z-line, beta
NCBI Official Symbol
CAPZB
NCBI Official Synonym Symbols
CAPB; CAPZ; CAPPB
NCBI Protein Information
F-actin-capping protein subunit beta
Protein Family

NCBI Description

This gene encodes the beta subunit of the barbed-end actin binding protein, which belongs to the F-actin capping protein family. The capping protein is a heterodimeric actin capping protein that blocks actin filament assembly and disassembly at the fast growing (barbed) filament ends and functions in regulating actin filament dynamics as well as in stabilizing actin filament lengths in muscle and nonmuscle cells. A pseudogene of this gene is located on the long arm of chromosome 2. Multiple alternatively spliced transcript variants encoding different isoforms have been found.[provided by RefSeq, Aug 2013]

Research Articles on CAPZB

Similar Products

Product Notes

The CAPZB (Catalog #AAA6156876) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CAPZB (F-actin-capping Protein Subunit beta, CapZ beta) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CAPZB can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CAPZB for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CAPZB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.