Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CAND1 monoclonal antibody (M02), clone 5F2 Western Blot analysis of CAND1 expression in Hela S3 NE (Cat # L013V3).)

Mouse CAND1 Monoclonal Antibody | anti-CAND1 antibody

CAND1 (Cullin-Associated and Neddylation-dissociated 1, DKFZp434M1414, FLJ10114, FLJ10929, FLJ38691, FLJ90441, KIAA0829, TIP120, TIP120A) (FITC)

Gene Names
CAND1; TIP120; TIP120A
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
CAND1; Monoclonal Antibody; CAND1 (Cullin-Associated and Neddylation-dissociated 1; DKFZp434M1414; FLJ10114; FLJ10929; FLJ38691; FLJ90441; KIAA0829; TIP120; TIP120A) (FITC); Cullin-Associated and Neddylation-dissociated 1; TIP120A; anti-CAND1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
5F2
Specificity
Recognizes CAND1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CAND1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CAND1 (NP_060918, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CAND1 monoclonal antibody (M02), clone 5F2 Western Blot analysis of CAND1 expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB) (CAND1 monoclonal antibody (M02), clone 5F2 Western Blot analysis of CAND1 expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB)

(CAND1 monoclonal antibody (M02), clone 5F2. Western Blot analysis of CAND1 expression in NIH/3T3.)

Western Blot (WB) (CAND1 monoclonal antibody (M02), clone 5F2. Western Blot analysis of CAND1 expression in NIH/3T3.)

Western Blot (WB)

(CAND1 monoclonal antibody (M02), clone 5F2. Western Blot analysis of CAND1 expression in PC-12.)

Western Blot (WB) (CAND1 monoclonal antibody (M02), clone 5F2. Western Blot analysis of CAND1 expression in PC-12.)

Western Blot (WB)

(CAND1 monoclonal antibody (M02), clone 5F2. Western Blot analysis of CAND1 expression in Raw 264.7.)

Western Blot (WB) (CAND1 monoclonal antibody (M02), clone 5F2. Western Blot analysis of CAND1 expression in Raw 264.7.)
Related Product Information for anti-CAND1 antibody
Mouse monoclonal antibody raised against a partial recombinant CAND1.
Product Categories/Family for anti-CAND1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
136kDa
NCBI Official Full Name
cullin-associated NEDD8-dissociated protein 1 isoform 1
NCBI Official Synonym Full Names
cullin associated and neddylation dissociated 1
NCBI Official Symbol
CAND1
NCBI Official Synonym Symbols
TIP120; TIP120A
NCBI Protein Information
cullin-associated NEDD8-dissociated protein 1
UniProt Protein Name
Cullin-associated NEDD8-dissociated protein 1
UniProt Gene Name
CAND1
UniProt Synonym Gene Names
KIAA0829; TIP120; TIP120A; TBP-interacting protein 120A

NCBI Description

This gene encodes an essential regulator of Cullin-RING ubiquitin ligases, which are in involved in ubiquitinylation of proteins degraded by the Ub proteasome system. The encoded protein binds to unneddylated cullin-RING box protein complexes and acts as an inhibitor of cullin neddylation and of Skp1, cullin, and F box ubiquitin ligase complex assembly and activity. In mammalian cell culture, this protein predominantly localizes to the cytoplasm. Knockdown of this gene in preadipocytes results in blocked adipogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016]

Uniprot Description

Key assembly factor of SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complexes that promotes the exchange of the substrate-recognition F-box subunit in SCF complexes, thereby playing a key role in the cellular repertoire of SCF complexes. Acts as a F-box protein exchange factor. The exchange activity of CAND1 is coupled with cycles of neddylation conjugation: in the deneddylated state, cullin-binding CAND1 binds CUL1-RBX1, increasing dissociation of the SCF complex and promoting exchange of the F-box protein. Probably plays a similar role in other cullin-RING E3 ubiquitin ligase complexes.

Research Articles on CAND1

Similar Products

Product Notes

The CAND1 cand1 (Catalog #AAA6176880) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CAND1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CAND1 cand1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CAND1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.