Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GCNT4 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateGCNT4 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit GCNT4 Polyclonal Antibody | anti-GCNT4 antibody

GCNT4 antibody - C-terminal region

Gene Names
GCNT4; C2GNT3; LINC01336
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GCNT4; Polyclonal Antibody; GCNT4 antibody - C-terminal region; anti-GCNT4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGF
Sequence Length
453
Applicable Applications for anti-GCNT4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GCNT4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GCNT4 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateGCNT4 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-GCNT4 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateGCNT4 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-GCNT4 antibody
This is a rabbit polyclonal antibody against GCNT4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GCNT4 is a glycosyltransferase that mediates core 2 O-glycan branching, an important step in mucin-type biosynthesis. It does not have core 4 O-glycan or I-branching enzyme activity.
Product Categories/Family for anti-GCNT4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Synonym Full Names
glucosaminyl (N-acetyl) transferase 4
NCBI Official Symbol
GCNT4
NCBI Official Synonym Symbols
C2GNT3; LINC01336
NCBI Protein Information
beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4
UniProt Protein Name
Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4
UniProt Gene Name
GCNT4
UniProt Synonym Gene Names
C2GnT3
UniProt Entry Name
GCNT4_HUMAN

Uniprot Description

GCNT4: Glycosyltransferase that mediates core 2 O-glycan branching, an important step in mucin-type biosynthesis. Does not have core 4 O-glycan or I-branching enzyme activity. Belongs to the glycosyltransferase 14 family.

Protein type: Glycan Metabolism - O-glycan biosynthesis; EC 2.4.1.102; Membrane protein, integral; Transferase

Chromosomal Location of Human Ortholog: 5q12

Cellular Component: Golgi membrane; integral to membrane

Molecular Function: beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity; N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity

Biological Process: protein amino acid O-linked glycosylation; tissue morphogenesis; cellular protein metabolic process; O-glycan processing; carbohydrate metabolic process; homeostasis of number of cells; post-translational protein modification; thyroid hormone metabolic process

Similar Products

Product Notes

The GCNT4 gcnt4 (Catalog #AAA3208503) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GCNT4 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GCNT4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GCNT4 gcnt4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SKDTYSPDEH FWATLIRVPG IPGEISRSAQ DVSDLQSKTR LVKWNYYEGF. It is sometimes possible for the material contained within the vial of "GCNT4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.