Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged G10 is ~1ng/ml as a capture antibody.)

Mouse anti-Human BUD31 Monoclonal Antibody | anti-BUD31 antibody

BUD31 (Protein BUD31 homolog, Protein EDG-2, Protein G10 Homolog, EDG2, EDG-2, fSAP17, G10, MGC111202, YCR063W) (PE)

Gene Names
BUD31; G10; EDG2; Cwc14; EDG-2; fSAP17; YCR063W
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BUD31; Monoclonal Antibody; BUD31 (Protein BUD31 homolog; Protein EDG-2; Protein G10 Homolog; EDG2; EDG-2; fSAP17; G10; MGC111202; YCR063W) (PE); anti-BUD31 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1E10
Specificity
Recognizes human G10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-BUD31 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa35-144 from human G10 (NP_003901) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged G10 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged G10 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-BUD31 antibody
BUD31, also known as EDG2, is the homolog of BUD31 from Saccharomyces cerevisiae.
Product Categories/Family for anti-BUD31 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19.4kDa (167aa), confirmed by MALDI-TOF
NCBI Official Full Name
protein BUD31 homolog
NCBI Official Synonym Full Names
BUD31 homolog
NCBI Official Symbol
BUD31
NCBI Official Synonym Symbols
G10; EDG2; Cwc14; EDG-2; fSAP17; YCR063W
NCBI Protein Information
protein BUD31 homolog
UniProt Protein Name
Protein BUD31 homolog
Protein Family
UniProt Gene Name
BUD31
UniProt Synonym Gene Names
EDG2
UniProt Entry Name
BUD31_HUMAN

Uniprot Description

BUD31: Belongs to the BUD31 (G10) family.

Protein type: Transcription factor; Spliceosome

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: spliceosome; nucleus

Molecular Function: transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome

Research Articles on BUD31

Similar Products

Product Notes

The BUD31 bud31 (Catalog #AAA6157908) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BUD31 (Protein BUD31 homolog, Protein EDG-2, Protein G10 Homolog, EDG2, EDG-2, fSAP17, G10, MGC111202, YCR063W) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BUD31 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BUD31 bud31 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BUD31, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.