Mouse anti-Human PIP4K2A Monoclonal Antibody | anti-PIP4K2A antibody

PIP4K2A (Phosphatidylinositol-5-phosphate 4-kinase Type-2 alpha, 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha, Diphosphoinositide Kinase 2-alpha, PIP5KIII, Phosphatidylinositol-5-phosphate 4-kinase Type II alpha, PI(5)P 4-kinase Type II alpha, PIP4

Cat. Num. AAA6148874

• Gene Names: PIP4K2A; PIPK; PI5P4KA; PIP5K2A; PIP5KIIA; PIP5KII-alpha
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PIP4K2A; Monoclonal Antibody; PIP4K2A (Phosphatidylinositol-5-phosphate 4-kinase Type-2 alpha; 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha; Diphosphoinositide Kinase 2-alpha; PIP5KIII; Phosphatidylinositol-5-phosphate 4-kinase Type II alpha; PI(5)P 4-kinase Type II alpha; PIP4; anti-PIP4K2A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3A3
• Specificity: Recognizes human PIP5K2A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-PIP4K2A antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa304-366 from human PIP5K2A (NP_005019) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKEVYFMAIIDILTHYD
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.56kD).)

Western Blot (WB)

(PIP5K2A monoclonal antibody. Western Blot analysis of PIP5K2A expression in K-562.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PIP5K2A on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PIP5K2A is ~3ng/ml as a capture antibody.)

Product Categories/Family for anti-PIP4K2A antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 6857820
• NCBI GeneID: 5305
• NCBI Accession #: NP_005019
• NCBI GenBank Nucleotide #: NM_005028
• UniProt Accession #: P48426; P53807; Q5VUX3; B0YJ66; B4DGX2; D3DRV1
• Molecular Weight: 39,802 Da
• NCBI Official Full Name: phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
• NCBI Official Synonym Full Names: phosphatidylinositol-5-phosphate 4-kinase, type II, alpha
• NCBI Official Symbol: PIP4K2A
• NCBI Official Synonym Symbols: PIPK; PI5P4KA; PIP5K2A; PIP5KIIA; PIP5KII-alpha
• NCBI Protein Information: phosphatidylinositol 5-phosphate 4-kinase type-2 alpha; 1-phosphatidylinositol 5-phosphate 4-kinase 2-alpha; 1-phosphatidylinositol-4-phosphate kinase; 1-phosphatidylinositol-4-phosphate-5-kinase; 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha; PI(5)
• UniProt Protein Name: Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
• Protein Family: Phosphatidylinositol 5-phosphate 4-kinase
• UniProt Gene Name: PIP4K2A
• UniProt Synonym Gene Names: PIP5K2; PIP5K2A; PI(5)P 4-kinase type II alpha; PIP4KII-alpha
• UniProt Entry Name: PI42A_HUMAN

Uniprot Description

PIP4K2A: Catalyzes the phosphorylation of phosphatidylinositol 5- phosphate (PtdIns5P) on the fourth hydroxyl of the myo-inositol ring, to form phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). May exert its function by regulating the levels of PtdIns5P, which functions in the cytosol by increasing AKT activity and in the nucleus signals through ING2. May regulate the pool of cytosolic PtdIns5P in response to the activation of tyrosine phosphorylation. May negatively regulate insulin- stimulated glucose uptake by lowering the levels of PtdIns5P. May be involved in thrombopoiesis, and the terminal maturation of megakaryocytes and regulation of their size.

Protein type: EC 2.7.1.149; Motility/polarity/chemotaxis; Kinase, lipid; Carbohydrate Metabolism - inositol phosphate

Chromosomal Location of Human Ortholog: 10p12.2

Cellular Component: plasma membrane; cytosol; nucleus

Molecular Function: 1-phosphatidylinositol-4-phosphate 5-kinase activity; 1-phosphatidylinositol-5-phosphate 4-kinase activity; ATP binding

Biological Process: phosphoinositide phosphorylation; phospholipid metabolic process; phosphatidylinositol biosynthetic process