Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human BRD8 Monoclonal Antibody | anti-BRD8 antibody

BRD8 (Bromodomain-containing Protein 8, Skeletal Muscle Abundant Protein, Skeletal Muscle Abundant Protein 2, Thyroid Hormone Receptor Coactivating Protein of 120kD, TrCP120, p120, SMAP, SMAP2) (MaxLight 750)

Gene Names
BRD8; SMAP; p120; SMAP2
Reactivity
Human
Applications
Immunofluorescence
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BRD8; Monoclonal Antibody; BRD8 (Bromodomain-containing Protein 8; Skeletal Muscle Abundant Protein; Skeletal Muscle Abundant Protein 2; Thyroid Hormone Receptor Coactivating Protein of 120kD; TrCP120; p120; SMAP; SMAP2) (MaxLight 750); anti-BRD8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3G8
Specificity
Recognizes human BRD8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-BRD8 antibody
FLISA, Immunofluorescence (IF)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa33-128 from human BRD8 (NP_631938) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RSGDQNWVSVSRAIKPFAEPGRPPDWFSQKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQERYRRLKRDAEL
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-BRD8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
135kDa
NCBI Official Full Name
bromodomain-containing protein 8 isoform 2
NCBI Official Synonym Full Names
bromodomain containing 8
NCBI Official Symbol
BRD8
NCBI Official Synonym Symbols
SMAP; p120; SMAP2
NCBI Protein Information
bromodomain-containing protein 8
UniProt Protein Name
Bromodomain-containing protein 8
UniProt Gene Name
BRD8
UniProt Synonym Gene Names
SMAP; SMAP2; TrCP120
UniProt Entry Name
BRD8_HUMAN

NCBI Description

The protein encoded by this gene interacts with thyroid hormone receptor in a ligand-dependent manner and enhances thyroid hormone-dependent activation from thyroid response elements. This protein contains a bromodomain and is thought to be a nuclear receptor coactivator. Multiple alternatively spliced transcript variants that encode distinct isoforms have been identified. [provided by RefSeq, Jul 2014]

Uniprot Description

BRD8 iso1: May act as a coactivator during transcriptional activation by hormone-activated nuclear receptors (NR). Isoform 2 stimulates transcriptional activation by AR/DHTR, ESR1/NR3A1, RXRA/NR2B1 and THRB/ERBA2. At least isoform 1 and isoform 2 are components of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: nucleoplasm; NuA4 histone acetyltransferase complex; mitochondrion; nucleus

Molecular Function: thyroid hormone receptor activity; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; establishment and/or maintenance of chromatin architecture; intracellular receptor-mediated signaling pathway; cell surface receptor linked signal transduction; regulation of transcription, DNA-dependent; transcription, DNA-dependent; regulation of growth; signal transduction

Research Articles on BRD8

Similar Products

Product Notes

The BRD8 brd8 (Catalog #AAA6231811) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BRD8 (Bromodomain-containing Protein 8, Skeletal Muscle Abundant Protein, Skeletal Muscle Abundant Protein 2, Thyroid Hormone Receptor Coactivating Protein of 120kD, TrCP120, p120, SMAP, SMAP2) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BRD8 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BRD8 brd8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BRD8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.