Mouse anti-Human BRD8 Monoclonal Antibody | anti-BRD8 antibody

BRD8 (Bromodomain-containing Protein 8, Skeletal Muscle Abundant Protein, Skeletal Muscle Abundant Protein 2, Thyroid Hormone Receptor Coactivating Protein of 120kD, TrCP120, p120, SMAP, SMAP2) (Biotin)

Cat. Num. AAA6140854

• Gene Names: BRD8; SMAP; p120; SMAP2
• Reactivity: Human
• Applications: ELISA, Immunofluorescence
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BRD8; Monoclonal Antibody; BRD8 (Bromodomain-containing Protein 8; Skeletal Muscle Abundant Protein; Skeletal Muscle Abundant Protein 2; Thyroid Hormone Receptor Coactivating Protein of 120kD; TrCP120; p120; SMAP; SMAP2) (Biotin); anti-BRD8 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3G8
• Specificity: Recognizes human BRD8.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-BRD8 antibody: ELISA (EIA), Immunofluorescence (IF)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa33-128 from human BRD8 (NP_631938) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RSGDQNWVSVSRAIKPFAEPGRPPDWFSQKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQERYRRLKRDAEL
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to BRD8 on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-BRD8 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 34452707
• NCBI GeneID: 10902
• NCBI Accession #: NP_631938
• NCBI GenBank Nucleotide #: NM_139199
• UniProt Accession #: Q9H0E9
• Molecular Weight: 135kDa
• NCBI Official Full Name: bromodomain-containing protein 8 isoform 2
• NCBI Official Synonym Full Names: bromodomain containing 8
• NCBI Official Symbol: BRD8
• NCBI Official Synonym Symbols: SMAP; p120; SMAP2
• NCBI Protein Information: bromodomain-containing protein 8
• UniProt Protein Name: Bromodomain-containing protein 8
• Protein Family: Bromodomain-containing protein
• UniProt Gene Name: BRD8
• UniProt Synonym Gene Names: SMAP; SMAP2; TrCP120
• UniProt Entry Name: BRD8_HUMAN

NCBI Description

The protein encoded by this gene interacts with thyroid hormone receptor in a ligand-dependent manner and enhances thyroid hormone-dependent activation from thyroid response elements. This protein contains a bromodomain and is thought to be a nuclear receptor coactivator. Multiple alternatively spliced transcript variants that encode distinct isoforms have been identified. [provided by RefSeq, Jul 2014]

Uniprot Description

BRD8 iso1: May act as a coactivator during transcriptional activation by hormone-activated nuclear receptors (NR). Isoform 2 stimulates transcriptional activation by AR/DHTR, ESR1/NR3A1, RXRA/NR2B1 and THRB/ERBA2. At least isoform 1 and isoform 2 are components of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: nucleoplasm; NuA4 histone acetyltransferase complex; mitochondrion; nucleus

Molecular Function: thyroid hormone receptor activity; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; establishment and/or maintenance of chromatin architecture; intracellular receptor-mediated signaling pathway; cell surface receptor linked signal transduction; regulation of transcription, DNA-dependent; transcription, DNA-dependent; regulation of growth; signal transduction