Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human BLM Monoclonal Antibody | anti-BLM antibody

BLM (Bloom Syndrome Protein, RecQ Protein-like 3, DNA Helicase, RecQ-like Type 2, RECQL3, RECQ2) (AP)

Gene Names
BLM; BS; RECQ2; RECQL2; RECQL3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BLM; Monoclonal Antibody; BLM (Bloom Syndrome Protein; RecQ Protein-like 3; DNA Helicase; RecQ-like Type 2; RECQL3; RECQ2) (AP); anti-BLM antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E4
Specificity
Recognizes human BLM.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-BLM antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1196-1295 from human BLM (NP_000048) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDS
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to BLM on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to BLM on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-BLM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
641
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
159,000 Da
NCBI Official Full Name
Bloom syndrome protein isoform 1
NCBI Official Synonym Full Names
Bloom syndrome, RecQ helicase-like
NCBI Official Symbol
BLM
NCBI Official Synonym Symbols
BS; RECQ2; RECQL2; RECQL3
NCBI Protein Information
Bloom syndrome protein; DNA helicase, RecQ-like type 2; recQ protein-like 3
UniProt Protein Name
Bloom syndrome protein
Protein Family
UniProt Gene Name
BLM
UniProt Synonym Gene Names
RECQ2; RECQL3; RecQ2
UniProt Entry Name
BLM_HUMAN

Uniprot Description

BLM: a magnesium-dependent ATP-dependent DNA-helicase that unwinds single- and double-stranded DNA in a 3'-5' direction. A member of the RecQ helicase family that is required for genome stability. Participates in DNA replication, recombination and repair. Part of the BRCA1-associated genome surveillance complex (BASC), which contains BRCA1, MSH2, MSH6, MLH1, ATM, BLM, PMS2 and the RAD50-MRE11-NBS1 protein complex which is a dynamic process changing throughout the cell cycle and within subnuclear domains. Interacts with ubiquitinated FANCD2.

Protein type: DNA repair, damage; DNA replication; Helicase; EC 3.6.4.12

Chromosomal Location of Human Ortholog: 15q26.1

Cellular Component: male germ cell nucleus; nuclear chromosome; lateral element; chromosome, telomeric region; PML body; nuclear matrix; pronucleus; cytoplasm; nucleolus; replication fork; nucleus

Molecular Function: four-way junction helicase activity; G-quadruplex DNA binding; ATP-dependent DNA helicase activity; protein binding; ATP-dependent 3'-5' DNA helicase activity; p53 binding; ATPase activity; ATP-dependent helicase activity; bubble DNA binding; helicase activity; single-stranded DNA binding; ATP binding

Biological Process: negative regulation of DNA recombination; regulation of binding; positive regulation of transcription, DNA-dependent; negative regulation of mitotic recombination; DNA double-strand break processing; alpha-beta T cell differentiation; negative regulation of cell division; DNA repair; double-strand break repair via homologous recombination; DNA duplex unwinding; protein oligomerization; DNA recombination; replication fork processing; mitotic cell cycle G2/M transition DNA damage checkpoint; DNA strand renaturation; positive regulation of alpha-beta T cell proliferation; replication fork protection; regulation of cyclin-dependent protein kinase activity; response to DNA damage stimulus; telomere maintenance; response to X-ray

Disease: Bloom Syndrome

Similar Products

Product Notes

The BLM blm (Catalog #AAA6130223) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BLM (Bloom Syndrome Protein, RecQ Protein-like 3, DNA Helicase, RecQ-like Type 2, RECQL3, RECQ2) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BLM can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BLM blm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BLM, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.