Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for is 3ng/ml as a capture antibody.)

Mouse anti-Human BIM Monoclonal Antibody | anti-BIM antibody

BIM (Bcl2-interacting Mediator of Cell Death, BimEL, BimL, BIM-alpha6, BIM-beta6, BIM-beta7, BAM, BCL2-like 11 Apoptosis Facilitator, Bcl-2-like Protein 11, BCL2L11, Bcl2-L-11, BOD) (MaxLight 405)

Gene Names
BCL2L11; BAM; BIM; BOD
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BIM; Monoclonal Antibody; BIM (Bcl2-interacting Mediator of Cell Death; BimEL; BimL; BIM-alpha6; BIM-beta6; BIM-beta7; BAM; BCL2-like 11 Apoptosis Facilitator; Bcl-2-like Protein 11; BCL2L11; Bcl2-L-11; BOD) (MaxLight 405); anti-BIM antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F10
Specificity
Recognizes human BIM.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-BIM antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-100 from human BIM with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for is 3ng/ml as a capture antibody.)
Related Product Information for anti-BIM antibody
Bim belongs to Bcl-2 family of proteins containing Bcl-2 homology domain3 (BH3). It is proapoptotic and exerts its effects by interacting with prosurvival members of the Bcl-2 family like Bcl-2, Bcl-XL and Bcl-w. It exhibits three splice variants; BimL, BimS and BimEL. They all share homology in their C-terminal BH3 domain and are ubiquitously expressed. BimS is the strongest of them with respect to the proapoptotic capacity.
Product Categories/Family for anti-BIM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
8,523 Da
NCBI Official Full Name
bcl-2-like protein 11 isoform 1
NCBI Official Synonym Full Names
BCL2-like 11 (apoptosis facilitator)
NCBI Official Symbol
BCL2L11
NCBI Official Synonym Symbols
BAM; BIM; BOD
NCBI Protein Information
bcl-2-like protein 11; bcl-2 interacting protein Bim; bcl-2-related ovarian death agonist; bcl-2 interacting mediator of cell death
UniProt Protein Name
Bcl-2-like protein 11
UniProt Gene Name
BCL2L11
UniProt Synonym Gene Names
BIM; Bcl2-L-11
UniProt Entry Name
B2L11_HUMAN

NCBI Description

The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains a Bcl-2 homology domain 3 (BH3). It has been shown to interact with other members of the BCL-2 protein family and to act as an apoptotic activator. The expression of this gene can be induced by nerve growth factor (NGF), as well as by the forkhead transcription factor FKHR-L1, which suggests a role of this gene in neuronal and lymphocyte apoptosis. Transgenic studies of the mouse counterpart suggested that this gene functions as an essential initiator of apoptosis in thymocyte-negative selection. Several alternatively spliced transcript variants of this gene have been identified. [provided by RefSeq, Jun 2013]

Uniprot Description

BIM: a pro-apoptotic member of the BCL-2 protein family. Interacts with other members of the BCL-2 protein family, including BCL2, BCL2L1/BCL-X(L), and MCL1, and act as an apoptotic activator. Its expression can be induced by nerve growth factor (NGF), as well as by the forkhead transcription factor FKHR-L1, which suggests a role in neuronal and lymphocyte apoptosis. Transgenic studies in the mouse suggested that this protein functions as an essential initiator of the apoptosis in thymocyte-negative selection. Nineteen alternatively spliced transcript variants of this gene have been reported.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 2q13

Cellular Component: microtubule; mitochondrial outer membrane; extrinsic to membrane; endomembrane system; cytosol

Molecular Function: protein binding; microtubule binding

Biological Process: nerve growth factor receptor signaling pathway; positive regulation of apoptosis; apoptosis; cell-matrix adhesion; pigmentation during development; myeloid cell homeostasis; ear development; positive regulation of caspase activity; B cell apoptosis; cellular process regulating host cell cycle in response to virus; positive regulation of apoptosis by virus; mammary gland development; B cell homeostasis; positive regulation of neuron apoptosis; T cell homeostasis; kidney development; post-embryonic organ morphogenesis; caspase activation; spleen development; thymus development; in utero embryonic development; positive regulation of protein homooligomerization; male gonad development; positive regulation of cell cycle; regulation of organ growth; lumen formation; odontogenesis of dentine-containing teeth; DNA damage response, signal transduction resulting in induction of apoptosis; regulation of pigmentation during development; spermatogenesis; brain development

Research Articles on BIM

Similar Products

Product Notes

The BIM bcl2l11 (Catalog #AAA6189083) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BIM (Bcl2-interacting Mediator of Cell Death, BimEL, BimL, BIM-alpha6, BIM-beta6, BIM-beta7, BAM, BCL2-like 11 Apoptosis Facilitator, Bcl-2-like Protein 11, BCL2L11, Bcl2-L-11, BOD) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BIM can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BIM bcl2l11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BIM, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.