Western Blot (WB)
(Western Blot detection against Immunogen (34.91kD).)
Mouse anti-Human BHLHE41 Monoclonal Antibody | anti-bhlhe41 antibody
BHLHE41 (BHLHB3, Class E Basic Helix-loop-helix Protein 41, bHLHe41, Class B Basic Helix-loop-helix Protein 3, bHLHb3, Differentially Expressed in Chondrocytes Protein 2, Differentially Expressed in Chondrocytes Protein 2, hDEC2, Enhancer-of-split and Hai
Gene Names
bhlhe41; dec2; bhlhb3; sharp1; sharp-1
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
BHLHE41; Monoclonal Antibody; BHLHE41 (BHLHB3; Class E Basic Helix-loop-helix Protein 41; bHLHe41; Class B Basic Helix-loop-helix Protein 3; bHLHb3; Differentially Expressed in Chondrocytes Protein 2; hDEC2; Enhancer-of-split and Hai; Anti -BHLHE41 (BHLHB3; anti-bhlhe41 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4H6
Specificity
Recognizes human BHLHB3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
CLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRMKL
Applicable Applications for anti-bhlhe41 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa203-283 from human BHLHB3 (NP_110389) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (34.91kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (34.91kD).)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to BHLHE41 on HeLa cell . [antibody concentration 10ug/ml].)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to BHLHE41 on HeLa cell . [antibody concentration 10ug/ml].)
Testing Data
(Detection limit for recombinant GST tagged BHLHE41 is 1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged BHLHE41 is 1ng/ml as a capture antibody.)
Related Product Information for anti-bhlhe41 antibody
BHLHE41 may be a transcriptional repressor that represses both basal and activated transcription.
Product Categories/Family for anti-bhlhe41 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
basic helix-loop-helix family, member e41
NCBI Official Synonym Full Names
basic helix-loop-helix family, member e41
NCBI Official Symbol
bhlhe41
NCBI Official Synonym Symbols
dec2; bhlhb3; sharp1; sharp-1
NCBI Protein Information
basic helix-loop-helix family, member e41; basic helix-loop-helix domain containing, class B, 3
Protein Family
Similar Products
Product Notes
The bhlhe41 (Catalog #AAA6004157) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BHLHE41 (BHLHB3, Class E Basic Helix-loop-helix Protein 41, bHLHe41, Class B Basic Helix-loop-helix Protein 3, bHLHb3, Differentially Expressed in Chondrocytes Protein 2, Differentially Expressed in Chondrocytes Protein 2, hDEC2, Enhancer-of-split and Hai reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BHLHE41 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the bhlhe41 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CLERAGQKLE PLAYCVPVIQ RTQPSAELAA ENDTDTDSGY GGEAEARPDR EKGKGAGASR VTIKQEPPGE DSPAPKRMKL. It is sometimes possible for the material contained within the vial of "BHLHE41, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
