Western Blot (WB)
(Western Blot detection against immunogen (36.74kD) usingMBS6003838.)
Mouse anti-Human Bestrophin-1 Monoclonal Antibody | anti-BEST1 antibody
Bestrophin-1 (BEST1, BEST, TU15B, Vitelliform Macular Dystrophy Protein 2, VMD2, ARB, BMD, RP50) (PE)
Gene Names
BEST1; ARB; BMD; BEST; RP50; VMD2; TU15B; Best1V1Delta2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Bestrophin-1; Monoclonal Antibody; Bestrophin-1 (BEST1; BEST; TU15B; Vitelliform Macular Dystrophy Protein 2; VMD2; ARB; BMD; RP50) (PE); anti-BEST1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C2
Specificity
Recognizes human Bestrophin-1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
2435
Applicable Applications for anti-BEST1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa361-460 from human Bestrophin-1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LHEGLPKNHKAAKQNVRGQEDNKAWKLKAVDAFKSAPLYQRPGYYSAPQTPLSPTPMFFPLEPSAPSKLHSVTGIDTKDKSLKTVSSGAKKSFELLSESD
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against immunogen (36.74kD) usingMBS6003838.)
Western Blot (WB)
(Western Blot detection against immunogen (36.74kD) usingMBS6003838.)
Product Categories/Family for anti-BEST1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens bestrophin 1, mRNA
NCBI Official Synonym Full Names
bestrophin 1
NCBI Official Symbol
BEST1
NCBI Official Synonym Symbols
ARB; BMD; BEST; RP50; VMD2; TU15B; Best1V1Delta2
NCBI Protein Information
bestrophin-1
Protein Family
NCBI Description
This gene encodes a member of the bestrophin gene family. This small gene family is characterized by proteins with a highly conserved N-terminus with four to six transmembrane domains. Bestrophins may form chloride ion channels or may regulate voltage-gated L-type calcium-ion channels. Bestrophins are generally believed to form calcium-activated chloride-ion channels in epithelial cells but they have also been shown to be highly permeable to bicarbonate ion transport in retinal tissue. Mutations in this gene are responsible for juvenile-onset vitelliform macular dystrophy (VMD2), also known as Best macular dystrophy, in addition to adult-onset vitelliform macular dystrophy (AVMD) and other retinopathies. Alternative splicing results in multiple variants encoding distinct isoforms.[provided by RefSeq, Nov 2008]
Research Articles on BEST1
Similar Products
Product Notes
The BEST1 (Catalog #AAA6161050) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Bestrophin-1 (BEST1, BEST, TU15B, Vitelliform Macular Dystrophy Protein 2, VMD2, ARB, BMD, RP50) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Bestrophin-1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BEST1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Bestrophin-1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
