Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against immunogen (36.74kD) using MBS6003838.)

Mouse anti-Human Bestrophin-1 Monoclonal Antibody | anti-Best1 antibody

Bestrophin-1 (BEST1, BEST, TU15B, Vitelliform Macular Dystrophy Protein 2, VMD2, ARB, BMD, RP50)

Gene Names
Best1; Bmd; Vmd2; mBest1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
Bestrophin-1; Monoclonal Antibody; Bestrophin-1 (BEST1; BEST; TU15B; Vitelliform Macular Dystrophy Protein 2; VMD2; ARB; BMD; RP50); Anti -Bestrophin-1 (BEST1; anti-Best1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C2
Specificity
Recognizes human VMD2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
LHEGLPKNHKAAKQNVRGQEDNKAWKLKAVDAFKSAPLYQRPGYYSAPQTPLSPTPMFFPLEPSAPSKLHSVTGIDTKDKSLKTVSSGAKKSFELLSESD
Applicable Applications for anti-Best1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa361-460 from human VMD2 (AAH41664) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen (36.74kD) using MBS6003838.)

Western Blot (WB) (Western Blot detection against immunogen (36.74kD) using MBS6003838.)
Product Categories/Family for anti-Best1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63,684 Da
NCBI Official Full Name
bestrophin-1
NCBI Official Synonym Full Names
bestrophin 1
NCBI Official Symbol
Best1
NCBI Official Synonym Symbols
Bmd; Vmd2; mBest1
NCBI Protein Information
bestrophin-1; best macular dystrophy; vitelliform macular dystrophy 2 homolog; vitelliform macular dystrophy protein 2 homolog
UniProt Protein Name
Bestrophin-1
Protein Family
UniProt Gene Name
Best1
UniProt Synonym Gene Names
Bmd1; Vmd2
UniProt Entry Name
BEST1_MOUSE

Uniprot Description

BEST1: Forms calcium-sensitive chloride channels. Highly permeable to bicarbonate. Defects in BEST1 are the cause of vitelliform macular dystrophy type 2 (VMD2); also known as Best macular dystrophy (BMD). VMD2 is an autosomal dominant form of macular degeneration that usually begins in childhood or adolescence. VMD2 is characterized by typical 'egg-yolk' macular lesions due to abnormal accumulation of lipofuscin within and beneath the retinal pigment epithelium cells. Progression of the disease leads to destruction of the retinal pigment epithelium and vision loss. Defects in BEST1 are the cause of retinitis pigmentosa type 50 (RP50). A retinal dystrophy belonging to the group of pigmentary retinopathies. RP is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. Defects in BEST1 are a cause of adult-onset vitelliform macular dystrophy (AVMD). AVMD is a rare autosomal dominant disorder with incomplete penetrance and highly variable expression. Patients usually become symptomatic in the fourth or fifth decade of life with a protracted disease of decreased visual acuity. Defects in BEST1 are the cause of bestrophinopathy autosomal recessive (ARB). A retinopathy characterized by central visual loss, an absent electro-oculogram light rise, and a reduced electroretinogram. Defects in BEST1 are the cause of vitreoretinochoroidopathy autosomal dominant (ADVIRC). A disorder characterized by vitreoretinochoroidal dystrophy. The clinical presentation is variable and may be associated with cataract, nanophthalmos, microcornea, shallow anterior chamber, and glaucoma. Belongs to the bestrophin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, ion channel; Membrane protein, multi-pass; Membrane protein, integral; Transporter; Channel, chloride

Cellular Component: membrane; basolateral plasma membrane; plasma membrane; integral to membrane

Molecular Function: chloride channel activity

Biological Process: transport; transepithelial chloride transport; detection of light stimulus involved in visual perception; ion transport; chloride transport; regulation of calcium ion transport

Research Articles on Best1

Similar Products

Product Notes

The Best1 best1 (Catalog #AAA6003838) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Bestrophin-1 (BEST1, BEST, TU15B, Vitelliform Macular Dystrophy Protein 2, VMD2, ARB, BMD, RP50) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Bestrophin-1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the Best1 best1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LHEGLPKNHK AAKQNVRGQE DNKAWKLKAV DAFKSAPLYQ RPGYYSAPQT PLSPTPMFFP LEPSAPSKLH SVTGIDTKDK SLKTVSSGAK KSFELLSESD. It is sometimes possible for the material contained within the vial of "Bestrophin-1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.