Mouse anti-Human COL5A3 Monoclonal Antibody | anti-COL5A3 antibody

COL5A3 (Collagen alpha-3(V) Chain) (HRP)

Cat. Num. AAA6151901

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: COL5A3; Monoclonal Antibody; COL5A3 (Collagen alpha-3(V) Chain) (HRP); anti-COL5A3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4B8
• Specificity: Recognizes human COL5A3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 1745

• Applicable Applications for anti-COL5A3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa157-245 from human COL5A3 (NP_056534) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EMVTLVADCEAQPPVLGHGPRFISIAGLTVLGTQDLGEKTFEGDIQELLISPDPQAAFQACERYLPDCDNLAPAATVAPQGEPETPRP
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.79kD).)

Testing Data

(Detection limit for recombinant GST tagged COL5A3 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-COL5A3 antibody

Type V collagen is a member of group I collagen (fibrillar forming collagen). It is a minor connective tissue component of nearly ubiquitous distribution. Type V collagen binds to DNA, heparan sulfate, thrombospondin, heparin, and insulin.

Product Categories/Family for anti-COL5A3 antibody

Antibodies; Collagen

NCBI and Uniprot Product Information

• NCBI GI #: 110735435
• NCBI GeneID: 50509
• NCBI Accession #: NP_056534
• NCBI GenBank Nucleotide #: NM_015719
• UniProt Accession #: P25940
• NCBI Official Full Name: collagen alpha-3(V) chain preproprotein
• NCBI Official Synonym Full Names: collagen type V alpha 3 chain
• NCBI Official Symbol: COL5A3
• NCBI Protein Information: collagen alpha-3(V) chain
• UniProt Protein Name: Collagen alpha-3(V) chain
• Protein Family: Collagen
• UniProt Gene Name: COL5A3
• UniProt Entry Name: CO5A3_HUMAN

NCBI Description

This gene encodes an alpha chain for one of the low abundance fibrillar collagens. Fibrillar collagen molecules are trimers that can be composed of one or more types of alpha chains. Type V collagen is found in tissues containing type I collagen and appears to regulate the assembly of heterotypic fibers composed of both type I and type V collagen. This gene product is closely related to type XI collagen and it is possible that the collagen chains of types V and XI constitute a single collagen type with tissue-specific chain combinations. Mutations in this gene are thought to be responsible for the symptoms of a subset of patients with Ehlers-Danlos syndrome type III. Messages of several sizes can be detected in northern blots but sequence information cannot confirm the identity of the shorter messages. [provided by RefSeq, Jul 2008]

Uniprot Description

COL5A3: Type V collagen is a member of group I collagen (fibrillar forming collagen). It is a minor connective tissue component of nearly ubiquitous distribution. Type V collagen binds to DNA, heparan sulfate, thrombospondin, heparin, and insulin. Belongs to the fibrillar collagen family.

Protein type: Secreted; Extracellular matrix; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: collagen type V; endoplasmic reticulum lumen; extracellular region

Molecular Function: collagen binding; heparin binding; proteoglycan binding; extracellular matrix structural constituent

Biological Process: skin development; axon guidance; extracellular matrix disassembly; collagen catabolic process; extracellular matrix organization and biogenesis; collagen fibril organization; cell-matrix adhesion