Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.43kD).)

Mouse anti-Human BCL7B Monoclonal Antibody | anti-BCL7B antibody

BCL7B (B Cell CLL/Lymphoma 7 Protein Family Member B, Allergen=Hom s 3) APC

Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BCL7B; Monoclonal Antibody; BCL7B (B Cell CLL/Lymphoma 7 Protein Family Member B; Allergen=Hom s 3) APC; anti-BCL7B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6D2
Specificity
Recognizes human BCL7B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
202
Applicable Applications for anti-BCL7B antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa124-202 from BCL7B (NP_001698) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.43kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.43kD).)

Western Blot (WB)

(Western Blot analysis of BCL7B expression in transfected 293T cell line by BCL7B monoclonal antibody. Lane 1: BCL7B transfected lysate (22kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BCL7B expression in transfected 293T cell line by BCL7B monoclonal antibody. Lane 1: BCL7B transfected lysate (22kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to BCL7B on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to BCL7B on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged BCL7B is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged BCL7B is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-BCL7B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
B-cell CLL/lymphoma 7 protein family member B isoform 1
UniProt Protein Name
B-cell CLL/lymphoma 7 protein family member B
UniProt Gene Name
BCL7B
UniProt Entry Name
BCL7B_HUMAN

Uniprot Description

Function: May play a role in lung tumor development or progression.

Tissue specificity: Ubiquitous. Ref.2 Ref.3

Involvement in disease: BCL7B is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of BCL7B may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease. Ref.2 Ref.3

Allergenic properties: Causes an allergic reaction in human. Binds to IgE from atopic dermatitis (AD) patients. Identified as an IgE autoantigen in atopic dermatitis (AD) patients with severe skin manifestations. Ref.9

Sequence similarities: Belongs to the BCL7 family.

Similar Products

Product Notes

The BCL7B bcl7b (Catalog #AAA6135508) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BCL7B (B Cell CLL/Lymphoma 7 Protein Family Member B, Allergen=Hom s 3) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BCL7B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BCL7B bcl7b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BCL7B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.