Western Blot (WB)
(Host: RabbitTarget Name: Dkk4Antibody Dilution: 1.0ug/mlSample Type: Mouse Pancreas)
Rabbit Dkk4 Polyclonal Antibody | anti-DKK4 antibody
Dkk4 antibody - C-terminal region
Gene Names
Dkk4; Dkk-4
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Dkk4; Polyclonal Antibody; Dkk4 antibody - C-terminal region; anti-DKK4 antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RTSDCGPGLCCARHFWTKICKPVLREGQVCSRRGHKDTAQAPEIFQRCDC
Sequence Length
221
Applicable Applications for anti-DKK4 antibody
Western Blot (WB)
Homology
Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: Dkk4Antibody Dilution: 1.0ug/mlSample Type: Mouse Pancreas)
Western Blot (WB)
(Host: RabbitTarget Name: Dkk4Antibody Dilution: 1.0ug/mlSample Type: Mouse Pancreas)
Related Product Information for anti-DKK4 antibody
This is a rabbit polyclonal antibody against Dkk4. It was validated on Western Blot
Target Description: Dkk4 antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
Target Description: Dkk4 antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
Product Categories/Family for anti-DKK4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
dickkopf-related protein 4
NCBI Official Synonym Full Names
dickkopf WNT signaling pathway inhibitor 4
NCBI Official Symbol
Dkk4
NCBI Official Synonym Symbols
Dkk-4
NCBI Protein Information
dickkopf-related protein 4
UniProt Protein Name
Dickkopf-related protein 4
Protein Family
UniProt Gene Name
Dkk4
UniProt Synonym Gene Names
Dickkopf-4; Dkk-4
Uniprot Description
DKK4: Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero- posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. Belongs to the dickkopf family.
Protein type: Inhibitor; Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 8|8 A2
Biological Process: Wnt receptor signaling pathway
Research Articles on DKK4
Similar Products
Product Notes
The DKK4 dkk4 (Catalog #AAA3206358) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Dkk4 antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Dkk4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DKK4 dkk4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RTSDCGPGLC CARHFWTKIC KPVLREGQVC SRRGHKDTAQ APEIFQRCDC. It is sometimes possible for the material contained within the vial of "Dkk4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
