Mouse anti-Human BARD1 Monoclonal Antibody | anti-BARD1 antibody

BARD1 (BRCA1-associated RING Domain Protein 1, BARD-1) (AP)

Cat. Num. AAA6130182

• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BARD1; Monoclonal Antibody; BARD1 (BRCA1-associated RING Domain Protein 1; BARD-1) (AP); anti-BARD1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2A11
• Specificity: Recognizes human BARD1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 777

• Applicable Applications for anti-BARD1 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa658-757 from human BARD1 (NP_000456) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWK
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to BARD1 on HeLa cell. [antibody concentration 10ug/ml.)

Testing Data

(Detection limit for recombinant GST tagged BARD1 is ~3ng/ml as a capture antibody.)

Product Categories/Family for anti-BARD1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 157266328
• NCBI GeneID: 580
• NCBI Accession #: NP_000456
• NCBI GenBank Nucleotide #: NM_000465
• UniProt Accession #: Q99728
• NCBI Official Full Name: BRCA1-associated RING domain protein 1 isoform 1
• NCBI Official Synonym Full Names: BRCA1 associated RING domain 1
• NCBI Official Symbol: BARD1
• NCBI Protein Information: BRCA1-associated RING domain protein 1
• UniProt Protein Name: BRCA1-associated RING domain protein 1
• Protein Family: BRCA1-associated RING domain protein
• UniProt Gene Name: BARD1
• UniProt Synonym Gene Names: BARD-1
• UniProt Entry Name: BARD1_HUMAN

NCBI Description

This gene encodes a protein which interacts with the N-terminal region of BRCA1. In addition to its ability to bind BRCA1 in vivo and in vitro, it shares homology with the 2 most conserved regions of BRCA1: the N-terminal RING motif and the C-terminal BRCT domain. The RING motif is a cysteine-rich sequence found in a variety of proteins that regulate cell growth, including the products of tumor suppressor genes and dominant protooncogenes. This protein also contains 3 tandem ankyrin repeats. The BARD1/BRCA1 interaction is disrupted by tumorigenic amino acid substitutions in BRCA1, implying that the formation of a stable complex between these proteins may be an essential aspect of BRCA1 tumor suppression. This protein may be the target of oncogenic mutations in breast or ovarian cancer. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]

Uniprot Description

BARD1: the BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Plays a central role in the control of the cell cycle in response to DNA damage. Acts by mediating ubiquitin E3 ligase activity that is required for its tumor suppressor function. Also forms a heterodimer with CSTF1/CSTF-50 to modulate mRNA processing and RNAP II stability by inhibiting pre-mRNA 3' cleavage. Colocalizes with BRCA1 into discrete subnuclear foci during S phase. Can translocate to the cytoplasm. Localizes at sites of DNA damage at double-strand breaks (DSBs); recruitment to DNA damage sites is mediated by the BRCA1-A complex. Defects in BARD1 gene are found in primary breast, ovarian and uterine cancers.

Protein type: EC 6.3.2.-; EC 6.3.2.19; Ligase; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; BRCA1-BARD1 complex; cytoplasm; nucleolus; nucleus; ubiquitin ligase complex

Molecular Function: protein binding; protein homodimerization activity; zinc ion binding; protein heterodimerization activity; RNA binding; ubiquitin-protein ligase activity; kinase binding; ligase activity

Biological Process: negative regulation of mRNA 3'-end processing; negative regulation of protein export from nucleus; regulation of phosphorylation; positive regulation of apoptosis; tissue homeostasis; positive regulation of protein catabolic process; protein ubiquitination; DNA repair; cell cycle arrest; response to DNA damage stimulus; negative regulation of apoptosis

Disease: Breast Cancer