Mouse anti-Human, Rat BAIAP1 Monoclonal Antibody | anti-BAIAP1 antibody

BAIAP1 (MAGI1, Membrane-associated Guanylate Kinase, WW and PDZ Domain-containing Protein 1, BAI1-associated Protein 1, BAP-1, Membrane-associated Guanylate Kinase Inverted 1, MAGI-1, Atrophin-1-interacting Protein 3, AIP-3, WW Domain-containing Protein 3

Cat. Num. AAA6146086

• Gene Names: MAGI1; AIP3; BAP1; WWP3; AIP-3; BAP-1; BAIAP1; MAGI-1; Magi1d; TNRC19; MAGI-1b
• Reactivity: Human, Rat
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BAIAP1; Monoclonal Antibody; BAIAP1 (MAGI1; Membrane-associated Guanylate Kinase; WW and PDZ Domain-containing Protein 1; BAI1-associated Protein 1; BAP-1; Membrane-associated Guanylate Kinase Inverted 1; MAGI-1; Atrophin-1-interacting Protein 3; AIP-3; WW Domain-containing Protein 3; anti-BAIAP1 antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 7B4
• Specificity: Recognizes human MAGI1. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 6258

• Applicable Applications for anti-BAIAP1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa761-860 from MAGI1 (NP_004733) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQDIFLWRKETGFGFRILGGN
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(MAGI1 monoclonal antibody Western Blot analysis of MAGI1 expression in PC-12)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAGI1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MAGI1 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-BAIAP1 antibody

Antibodies; Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 1677495792
• NCBI GeneID: 9223
• NCBI Accession #: NM_004742.3
• NCBI GenBank Nucleotide #: NM_004742
• UniProt Accession #: Q96QZ7
• NCBI Official Full Name: Homo sapiens membrane associated guanylate kinase, WW and PDZ domain containing 1 (MAGI1), transcript variant 2, mRNA
• NCBI Official Synonym Full Names: membrane associated guanylate kinase, WW and PDZ domain containing 1
• NCBI Official Symbol: MAGI1
• NCBI Official Synonym Symbols: AIP3; BAP1; WWP3; AIP-3; BAP-1; BAIAP1; MAGI-1; Magi1d; TNRC19; MAGI-1b
• NCBI Protein Information: membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
• UniProt Protein Name: Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
• UniProt Gene Name: MAGI1
• UniProt Synonym Gene Names: AIP3; BAIAP1; BAP1; TNRC19; AIP-3; BAP-1; MAGI-1; WWP3
• UniProt Entry Name: MAGI1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the membrane-associated guanylate kinase homologue (MAGUK) family. MAGUK proteins participate in the assembly of multiprotein complexes on the inner surface of the plasma membrane at regions of cell-cell contact. The product of this gene may play a role as scaffolding protein at cell-cell junctions. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]