Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human, Rat BAIAP1 Monoclonal Antibody | anti-BAIAP1 antibody

BAIAP1 (MAGI1, Membrane-associated Guanylate Kinase, WW and PDZ Domain-containing Protein 1, BAI1-associated Protein 1, BAP-1, Membrane-associated Guanylate Kinase Inverted 1, MAGI-1, Atrophin-1-interacting Protein 3, AIP-3, WW Domain-containing Protein 3

Gene Names
MAGI1; AIP3; BAP1; WWP3; AIP-3; BAP-1; BAIAP1; MAGI-1; Magi1d; TNRC19; MAGI-1b
Reactivity
Human, Rat
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BAIAP1; Monoclonal Antibody; BAIAP1 (MAGI1; Membrane-associated Guanylate Kinase; WW and PDZ Domain-containing Protein 1; BAI1-associated Protein 1; BAP-1; Membrane-associated Guanylate Kinase Inverted 1; MAGI-1; Atrophin-1-interacting Protein 3; AIP-3; WW Domain-containing Protein 3; anti-BAIAP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
7B4
Specificity
Recognizes human MAGI1. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
6258
Applicable Applications for anti-BAIAP1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa761-860 from MAGI1 (NP_004733) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQDIFLWRKETGFGFRILGGN
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(MAGI1 monoclonal antibody Western Blot analysis of MAGI1 expression in PC-12)

Western Blot (WB) (MAGI1 monoclonal antibody Western Blot analysis of MAGI1 expression in PC-12)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAGI1 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MAGI1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MAGI1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MAGI1 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-BAIAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens membrane associated guanylate kinase, WW and PDZ domain containing 1 (MAGI1), transcript variant 2, mRNA
NCBI Official Synonym Full Names
membrane associated guanylate kinase, WW and PDZ domain containing 1
NCBI Official Symbol
MAGI1
NCBI Official Synonym Symbols
AIP3; BAP1; WWP3; AIP-3; BAP-1; BAIAP1; MAGI-1; Magi1d; TNRC19; MAGI-1b
NCBI Protein Information
membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
UniProt Protein Name
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
UniProt Gene Name
MAGI1
UniProt Synonym Gene Names
AIP3; BAIAP1; BAP1; TNRC19; AIP-3; BAP-1; MAGI-1; WWP3
UniProt Entry Name
MAGI1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the membrane-associated guanylate kinase homologue (MAGUK) family. MAGUK proteins participate in the assembly of multiprotein complexes on the inner surface of the plasma membrane at regions of cell-cell contact. The product of this gene may play a role as scaffolding protein at cell-cell junctions. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Research Articles on BAIAP1

Similar Products

Product Notes

The BAIAP1 magi1 (Catalog #AAA6146086) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BAIAP1 (MAGI1, Membrane-associated Guanylate Kinase, WW and PDZ Domain-containing Protein 1, BAI1-associated Protein 1, BAP-1, Membrane-associated Guanylate Kinase Inverted 1, MAGI-1, Atrophin-1-interacting Protein 3, AIP-3, WW Domain-containing Protein 3 reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BAIAP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BAIAP1 magi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BAIAP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.