Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human BAG1 Monoclonal Antibody | anti-BAG1 antibody

BAG1 (BCL2-Associated Athanogene, BCL2-Associated Athanogene 1, RAP46) (MaxLight 490)

Gene Names
BAG1; HAP; BAG-1; RAP46
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
BAG1; Monoclonal Antibody; BAG1 (BCL2-Associated Athanogene; BCL2-Associated Athanogene 1; RAP46) (MaxLight 490); anti-BAG1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E2
Specificity
Recognizes human BAG1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-BAG1 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa241-345 from human BAG1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-BAG1 antibody
The oncogene BCL2 is a membrane protein that blocks a step in a pathway leading to apoptosis or programmed cell death. The protein encoded by this gene binds to BCL2 and is referred to as BCL2-associated athanogene. It enhances the anti-apoptotic effects of BCL2 and represents a link between growth factor receptors and anti-apoptotic mechanisms. At least three protein isoforms are encoded by this mRNA through the use of a non-AUG (CUG) start site, and alternative, downstream, AUG translation initiation sites.
Product Categories/Family for anti-BAG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
573
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,989 Da
NCBI Official Full Name
BCL2-associated athanogene isoform 1L
NCBI Official Synonym Full Names
BCL2-associated athanogene
NCBI Official Symbol
BAG1
NCBI Official Synonym Symbols
HAP; BAG-1; RAP46
NCBI Protein Information
BAG family molecular chaperone regulator 1; Bcl-2-binding protein; receptor-associated protein, 46-KD; Bcl-2 associating athanogene-1 protein; glucocortoid receptor-associated protein RAP46
UniProt Protein Name
BAG family molecular chaperone regulator 1
UniProt Gene Name
BAG1
UniProt Synonym Gene Names
HAP; BAG-1
UniProt Entry Name
BAG1_HUMAN

NCBI Description

The oncogene BCL2 is a membrane protein that blocks a step in a pathway leading to apoptosis or programmed cell death. The protein encoded by this gene binds to BCL2 and is referred to as BCL2-associated athanogene. It enhances the anti-apoptotic effects of BCL2 and represents a link between growth factor receptors and anti-apoptotic mechanisms. Multiple protein isoforms are encoded by this mRNA through the use of a non-AUG (CUG) initiation codon, and three alternative downstream AUG initiation codons. A related pseudogene has been defined on chromosome X. [provided by RefSeq, Feb 2010]

Research Articles on BAG1

Similar Products

Product Notes

The BAG1 bag1 (Catalog #AAA6204760) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BAG1 (BCL2-Associated Athanogene, BCL2-Associated Athanogene 1, RAP46) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BAG1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BAG1 bag1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BAG1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.