Mouse anti-Human B4GALT4 Monoclonal Antibody | anti-B4GALT4 antibody

B4GALT4 (Beta-1,4-galactosyltransferase 4, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4, N-acetyllactosamine synthase, Nal synthase, Lactotriaosylceramide beta-1,4-galactosyl

Cat. Num. AAA6146075

• Gene Names: B4GALT4; B4Gal-T4; beta4Gal-T4
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: B4GALT4; Monoclonal Antibody; B4GALT4 (Beta-1; 4-galactosyltransferase 4; UDP-Gal:beta-GlcNAc beta-1; UDP-galactose:beta-N-acetylglucosamine beta-1; N-acetyllactosamine synthase; Nal synthase; Lactotriaosylceramide beta-1; 4-galactosyl; anti-B4GALT4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5E2
• Specificity: Recognizes human B4GALT4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-B4GALT4 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa35-135 from human B4GALT4 (NP_003769) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNRE*
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western blot analysis of B4GALT4 over-expressed 293 cell line, cotransfected with B4GALT4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with B4GALT4 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Testing Data

(Detection limit for recombinant GST tagged B4GALT4 is ~0.1ng/ml as a capture antibody)

Western Blot (WB)

(Western Blot analysis of B4GALT4 expression in transfected 293T cell line by B4GALT4 monoclonal antibody Lane 1: B4GALT4 transfected lysate (40kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-B4GALT4 antibody

Antibodies; Enzymes; Glycosyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 9994175
• NCBI GeneID: 8702
• NCBI Accession #: NP_003769
• NCBI GenBank Nucleotide #: NM_003778
• UniProt Accession #: O60513; Q68D68; Q9BSW3; Q9C078
• Molecular Weight: 40,041 Da
• NCBI Official Full Name: beta-1,4-galactosyltransferase 4
• NCBI Official Synonym Full Names: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
• NCBI Official Symbol: B4GALT4
• NCBI Official Synonym Symbols: B4Gal-T4; beta4Gal-T4
• NCBI Protein Information: beta-1,4-galactosyltransferase 4; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 4; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4; beta-1,4-GalTase 4; beta-N-acetylglucosa
• UniProt Protein Name: Beta-1,4-galactosyltransferase 4
• Protein Family: Beta-1,4-galactosyltransferase
• UniProt Gene Name: B4GALT4
• UniProt Synonym Gene Names: Beta-1,4-GalTase 4; Beta4Gal-T4; b4Gal-T4
• UniProt Entry Name: B4GT4_HUMAN