Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human AXL Monoclonal Antibody | anti-AXL antibody

AXL (AXL Oncogene, AXL Receptor Tyrosine Kinase, AXL Transforming Gene, AXL Transforming Sequence/gene, Adhesion-related Kinase, Ark, Oncogene AXL, Tyrosine Protein Kinase Receptor, UFO, TYR07) (PE)

Gene Names
AXL; ARK; UFO; JTK11; Tyro7
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AXL; Monoclonal Antibody; AXL (AXL Oncogene; AXL Receptor Tyrosine Kinase; AXL Transforming Gene; AXL Transforming Sequence/gene; Adhesion-related Kinase; Ark; Oncogene AXL; Tyrosine Protein Kinase Receptor; UFO; TYR07) (PE); anti-AXL antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6C8
Specificity
Recognizes human AXL.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-AXL antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa30-140 from human AXL (AAH32229) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPY
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(AXL monoclonal antibody, Western Blot analysis of AXL expression in HeLa.)

Western Blot (WB) (AXL monoclonal antibody, Western Blot analysis of AXL expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of AXL expression in transfected 293T cell line by AXL monoclonal antibody. Lane 1: AXL transfected lysate (98kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AXL expression in transfected 293T cell line by AXL monoclonal antibody. Lane 1: AXL transfected lysate (98kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of AXL over-expressed 293 cell line, cotransfected with AXL Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with AXL monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of AXL over-expressed 293 cell line, cotransfected with AXL Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with AXL monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Testing Data

(Detection limit for recombinant GST tagged AXL is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AXL is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-AXL antibody
AXL is an 887aa proto-oncogene belonging to the protein kinase super family with a protein kinase domain, two Ig-like C2-type (immunoglobulin-like) domains and two fibronectin type-III domains. Unlike other receptor tyrosine kinases, AXL represents a unique novel structure in the extracellular region that juxtaposes IgL and FNIII repeats. AXL may function as a signal transducer between specific cell types of mesodermal origin and may transduce signals from the extracellular matrix into the cytoplasm by binding to growth factors like vitamin K-dependent protein growth-arrest-specific gene 6 (GAS6) and thus form heterodimer and heterotetramer. It plays an important role in the stimulation of cell proliferation and can also mediate cell aggregation by homophilic binding. In the case of filovirus infection, AXL seems to function as a cell entry factor. Studies reveal the transforming potential of AXL in patients with chronic myeloproliferative disorder or chronic myelocytic leukemia.
Product Categories/Family for anti-AXL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
558
Molecular Weight
97,377 Da
NCBI Official Full Name
Homo sapiens AXL receptor tyrosine kinase, mRNA
NCBI Official Synonym Full Names
AXL receptor tyrosine kinase
NCBI Official Symbol
AXL
NCBI Official Synonym Symbols
ARK; UFO; JTK11; Tyro7
NCBI Protein Information
tyrosine-protein kinase receptor UFO

NCBI Description

The protein encoded by this gene is a member of the Tyro3-Axl-Mer (TAM) receptor tyrosine kinase subfamily. The encoded protein possesses an extracellular domain which is composed of two immunoglobulin-like motifs at the N-terminal, followed by two fibronectin type-III motifs. It transduces signals from the extracellular matrix into the cytoplasm by binding to the vitamin K-dependent protein growth arrest-specific 6 (Gas6). This gene may be involved in several cellular functions including growth, migration, aggregation and anti-inflammation in multiple cell types. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013]

Research Articles on AXL

Similar Products

Product Notes

The AXL (Catalog #AAA6156671) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AXL (AXL Oncogene, AXL Receptor Tyrosine Kinase, AXL Transforming Gene, AXL Transforming Sequence/gene, Adhesion-related Kinase, Ark, Oncogene AXL, Tyrosine Protein Kinase Receptor, UFO, TYR07) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AXL can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AXL for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AXL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.