Mouse anti-Human AXL Monoclonal Antibody | anti-AXL antibody

AXL (AXL Oncogene, AXL Receptor Tyrosine Kinase, AXL Transforming Gene, AXL Transforming Sequence/gene, Adhesion-related Kinase, Ark, Oncogene AXL, Tyrosine Protein Kinase Receptor, UFO, TYR07) APC

Cat. Num. AAA6135459

• Gene Names: AXL; ARK; UFO; JTK11; Tyro7
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AXL; Monoclonal Antibody; AXL (AXL Oncogene; AXL Receptor Tyrosine Kinase; AXL Transforming Gene; AXL Transforming Sequence/gene; Adhesion-related Kinase; Ark; Oncogene AXL; Tyrosine Protein Kinase Receptor; UFO; TYR07) APC; anti-AXL antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6C8
• Specificity: Recognizes human AXL.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-AXL antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa30-140 from human AXL (AAH32229) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPY
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(AXL monoclonal antibody, Western Blot analysis of AXL expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of AXL expression in transfected 293T cell line by AXL monoclonal antibody. Lane 1: AXL transfected lysate (98kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of AXL over-expressed 293 cell line, cotransfected with AXL Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with AXL monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Testing Data

(Detection limit for recombinant GST tagged AXL is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-AXL antibody

AXL is an 887aa proto-oncogene belonging to the protein kinase super family with a protein kinase domain, two Ig-like C2-type (immunoglobulin-like) domains and two fibronectin type-III domains. Unlike other receptor tyrosine kinases, AXL represents a unique novel structure in the extracellular region that juxtaposes IgL and FNIII repeats. AXL may function as a signal transducer between specific cell types of mesodermal origin and may transduce signals from the extracellular matrix into the cytoplasm by binding to growth factors like vitamin K-dependent protein growth-arrest-specific gene 6 (GAS6) and thus form heterodimer and heterotetramer. It plays an important role in the stimulation of cell proliferation and can also mediate cell aggregation by homophilic binding. In the case of filovirus infection, AXL seems to function as a cell entry factor. Studies reveal the transforming potential of AXL in patients with chronic myeloproliferative disorder or chronic myelocytic leukemia.

Product Categories/Family for anti-AXL antibody

Antibodies; Receptor Tyrosine Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 21619003
• NCBI GeneID: 558
• Molecular Weight: 97,377 Da
• NCBI Official Full Name: Homo sapiens AXL receptor tyrosine kinase, mRNA
• NCBI Official Synonym Full Names: AXL receptor tyrosine kinase
• NCBI Official Symbol: AXL
• NCBI Official Synonym Symbols: ARK; UFO; JTK11; Tyro7
• NCBI Protein Information: tyrosine-protein kinase receptor UFO
• Protein Family: Tyrosine-protein kinase receptor

NCBI Description

The protein encoded by this gene is a member of the Tyro3-Axl-Mer (TAM) receptor tyrosine kinase subfamily. The encoded protein possesses an extracellular domain which is composed of two immunoglobulin-like motifs at the N-terminal, followed by two fibronectin type-III motifs. It transduces signals from the extracellular matrix into the cytoplasm by binding to the vitamin K-dependent protein growth arrest-specific 6 (Gas6). This gene may be involved in several cellular functions including growth, migration, aggregation and anti-inflammation in multiple cell types. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013]