Mouse anti-Human ATR Monoclonal Antibody | anti-ATR antibody

ATR (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia And Rad3-related Protein, FRAP-related Protein 1, FRP1) (FITC)

Cat. Num. AAA6146055

• Gene Names: ATR; FRP1; MEC1; SCKL; FCTCS; SCKL1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ATR; Monoclonal Antibody; ATR (Serine/Threonine-protein Kinase ATR; Ataxia Telangiectasia And Rad3-related Protein; FRAP-related Protein 1; FRP1) (FITC); anti-ATR antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3F2
• Specificity: Recognizes human ATR.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-ATR antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa2545-2644 from human ATR (NP_001175) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged ATP7B is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-ATR antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 157266317
• NCBI GeneID: 545
• NCBI Accession #: NP_001175
• NCBI GenBank Nucleotide #: NM_001184
• UniProt Accession #: Q13535; Q59HB2; Q7KYL3; Q93051; Q9BXK4
• Molecular Weight: 297,479 Da
• NCBI Official Full Name: serine/threonine-protein kinase ATR
• NCBI Official Synonym Full Names: ATR serine/threonine kinase
• NCBI Official Symbol: ATR
• NCBI Official Synonym Symbols: FRP1; MEC1; SCKL; FCTCS; SCKL1
• NCBI Protein Information: serine/threonine-protein kinase ATR; FRAP-related protein-1; MEC1, mitosis entry checkpoint 1, homolog; ataxia telangiectasia and Rad3-related protein
• UniProt Protein Name: Serine/threonine-protein kinase ATR
• Protein Family: Atrophin
• UniProt Gene Name: ATR
• UniProt Synonym Gene Names: FRP1
• UniProt Entry Name: ATR_HUMAN

Uniprot Description

ATR: a ser/thr kinase of the PIKK family most closely related to ATM. Activates checkpoint signaling upon genotoxic stresses such as ionizing radiation (IR), ultraviolet light (UV), or DNA replication stalling, thereby acting as a DNA damage sensor. Recognizes the substrate consensus sequence [ST]Q. Phosphorylates BRCA1, Chk1, MCM2, RAD17, RPA2, SMC1 and p53, which collectively inhibit DNA replication and mitosis and promote DNA repair, recombination and apoptosis. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX at sites of DNA damage, thereby regulating DNA damage response mechanism. Required for FANCD2 ubiquitination. Critical for maintenance of fragile site stability and efficient regulation of centrosome duplication.

Protein type: Kinase, lipid; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); Membrane protein, integral; Protein kinase, atypical; Kinase, protein; ATYPICAL group; PIKK family; ATR subfamily

Chromosomal Location of Human Ortholog: 3q23

Cellular Component: XY body; nucleoplasm; Golgi apparatus; PML body; chromosome

Molecular Function: protein dimerization activity; protein serine/threonine kinase activity; protein binding; DNA binding; MutLalpha complex binding; MutSalpha complex binding; ATP binding; protein kinase activity

Biological Process: response to drug; peptidyl-serine phosphorylation; negative regulation of DNA replication; multicellular organismal development; protein amino acid autophosphorylation; regulation of protein binding; DNA damage checkpoint; positive regulation of DNA damage response, signal transduction by p53 class mediator; DNA replication; cell cycle; DNA repair; response to DNA damage stimulus; double-strand break repair via homologous recombination

Disease: Seckel Syndrome 1; Cutaneous Telangiectasia And Cancer Syndrome, Familial