Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human ATP6V1A Monoclonal Antibody | anti-ATP6V1A antibody

ATP6V1A (V-type Proton ATPase Catalytic Subunit A, V-ATPase Subunit A, V-ATPase 69kD Subunit, Vacuolar ATPase Isoform VA68, Vacuolar Proton Pump Subunit alpha, ATP6A1, ATP6V1A1, VPP2) (FITC)

Gene Names
ATP6V1A; HO68; VA68; VPP2; Vma1; ATP6A1; ATP6V1A1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATP6V1A; Monoclonal Antibody; ATP6V1A (V-type Proton ATPase Catalytic Subunit A; V-ATPase Subunit A; V-ATPase 69kD Subunit; Vacuolar ATPase Isoform VA68; Vacuolar Proton Pump Subunit alpha; ATP6A1; ATP6V1A1; VPP2) (FITC); anti-ATP6V1A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4F5
Specificity
Recognizes human ATP6V1A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ATP6V1A antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa508-617 from human ATP6V1A (NP_001681) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSDYAQLLEDMQNAFRSLED
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(ATP6V1A monoclonal antibody. Western Blot analysis of ATP6V1A expression in human kidney.)

Western Blot (WB) (ATP6V1A monoclonal antibody. Western Blot analysis of ATP6V1A expression in human kidney.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ATP6V1A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ATP6V1A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ATP6V1A is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ATP6V1A is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-ATP6V1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
523
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64,736 Da
NCBI Official Full Name
V-type proton ATPase catalytic subunit A
NCBI Official Synonym Full Names
ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A
NCBI Official Symbol
ATP6V1A
NCBI Official Synonym Symbols
HO68; VA68; VPP2; Vma1; ATP6A1; ATP6V1A1
NCBI Protein Information
V-type proton ATPase catalytic subunit A; ATPase, H+ transporting, lysosomal, subunit A1; H(+)-transporting two-sector ATPase, subunit A; H+-transporting ATPase chain A, vacuolar (VA68 type); V-ATPase 69 kDa subunit 1; V-ATPase A subunit 1; V-ATPase subun
UniProt Protein Name
V-type proton ATPase catalytic subunit A
UniProt Gene Name
ATP6V1A
UniProt Synonym Gene Names
ATP6A1; ATP6V1A1; VPP2; V-ATPase subunit A
UniProt Entry Name
VATA_HUMAN

Uniprot Description

ATP6V1A: Catalytic subunit of the peripheral V1 complex of vacuolar ATPase. V-ATPase vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Belongs to the ATPase alpha/beta chains family.

Protein type: EC 3.6.3.14; Energy Metabolism - oxidative phosphorylation; Hydrolase

Chromosomal Location of Human Ortholog: 3q13.31

Cellular Component: microvillus; mitochondrion; integral to plasma membrane; lysosomal membrane; apical plasma membrane; plasma membrane; proton-transporting two-sector ATPase complex; cytosol

Molecular Function: hydrogen ion transporting ATPase activity, rotational mechanism; ATP binding

Biological Process: ATP metabolic process; interaction with host; cellular iron ion homeostasis; transport; ATP hydrolysis coupled proton transport; insulin receptor signaling pathway; transferrin transport; transmembrane transport

Similar Products

Product Notes

The ATP6V1A atp6v1a (Catalog #AAA6146042) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATP6V1A (V-type Proton ATPase Catalytic Subunit A, V-ATPase Subunit A, V-ATPase 69kD Subunit, Vacuolar ATPase Isoform VA68, Vacuolar Proton Pump Subunit alpha, ATP6A1, ATP6V1A1, VPP2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP6V1A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP6V1A atp6v1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP6V1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.