Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MAP2K1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MAP2K1 Polyclonal Antibody | anti-MAP2K1 antibody

MAP2K1 Antibody - middle region

Gene Names
MAP2K1; CFC3; MEK1; MKK1; MAPKK1; PRKMK1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MAP2K1; Polyclonal Antibody; MAP2K1 Antibody - middle region; anti-MAP2K1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYGMD
Sequence Length
393
Applicable Applications for anti-MAP2K1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MAP2K1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MAP2K1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MAP2K1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MAP2K1 antibody
The protein encoded by this gene is a member of the dual specificity protein kinase family, which acts as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein kinase lies upstream of MAP kinases and stimulates the enzymatic activity of MAP kinases upon wide variety of extra- and intracellular signals. As an essential component of MAP kinase signal transduction pathway, this kinase is involved in many cellular processes such as proliferation, differentiation, transcription regulation and development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43 kDa
NCBI Official Full Name
dual specificity mitogen-activated protein kinase kinase 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase 1
NCBI Official Symbol
MAP2K1
NCBI Official Synonym Symbols
CFC3; MEK1; MKK1; MAPKK1; PRKMK1
NCBI Protein Information
dual specificity mitogen-activated protein kinase kinase 1
UniProt Protein Name
Dual specificity mitogen-activated protein kinase kinase 1
UniProt Gene Name
MAP2K1
UniProt Synonym Gene Names
MEK1; PRKMK1; MAP kinase kinase 1; MAPKK 1; MKK1; MEK 1
UniProt Entry Name
MP2K1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the dual specificity protein kinase family, which acts as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein kinase lies upstream of MAP kinases and stimulates the enzymatic activity of MAP kinases upon wide variety of extra- and intracellular signals. As an essential component of MAP kinase signal transduction pathway, this kinase is involved in many cellular processes such as proliferation, differentiation, transcription regulation and development. [provided by RefSeq, Jul 2008]

Uniprot Description

MEK1: a dual-specificity protein kinase of the STE7 kinase family. Phosphorylated and activated by Raf, Mos and Cot kinases. Phosphorylates a Thr and a Tyr residue in a Thr-Glu-Tyr sequence located in the activation loop of ERK1 and ERK2. An essential component of MAP kinase signal transduction pathways involved in many cellular processes such as proliferation, differentiation, transcription regulation and development.

Protein type: Protein kinase, STE; Protein kinase, dual-specificity (non-receptor); EC 2.7.12.2; Kinase, protein; STE group; STE7 family

Chromosomal Location of Human Ortholog: 15q22.1-q22.33

Cellular Component: dendrite cytoplasm; Golgi apparatus; microtubule; focal adhesion; mitochondrion; endoplasmic reticulum; early endosome; perikaryon; cell cortex; cytosol; axon; perinuclear region of cytoplasm; cytoplasm; late endosome; plasma membrane; microtubule organizing center; nucleus

Molecular Function: MAP kinase kinase activity; protein serine/threonine kinase activity; protein serine/threonine kinase activator activity; protein binding; Ras GTPase binding; receptor signaling protein tyrosine phosphatase activity; protein-tyrosine kinase activity; protein serine/threonine/tyrosine kinase activity; mitogen-activated protein kinase kinase kinase binding; ATP binding; protein kinase activity

Biological Process: axon guidance; peptidyl-tyrosine phosphorylation; activation of MAPKK activity; nerve growth factor receptor signaling pathway; protein heterooligomerization; activation of MAPK activity; negative regulation of homotypic cell-cell adhesion; response to glucocorticoid stimulus; stress-activated MAPK cascade; cell motility involved in cell locomotion; pathogenesis; toll-like receptor 3 signaling pathway; chemotaxis; signal transduction; toll-like receptor 10 signaling pathway; neuron differentiation; toll-like receptor 5 signaling pathway; negative regulation of cell proliferation; positive regulation of RNA elongation from RNA polymerase II promoter; small GTPase mediated signal transduction; vesicle transport along microtubule; response to axon injury; cell cycle arrest; toll-like receptor 4 signaling pathway; Golgi inheritance; epidermal growth factor receptor signaling pathway; mitosis; fibroblast growth factor receptor signaling pathway; MyD88-independent toll-like receptor signaling pathway; MAPKKK cascade; melanosome transport; toll-like receptor 2 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; keratinocyte differentiation; regulation of stress-activated MAPK cascade; cell proliferation; regulation of vascular smooth muscle contraction; Ras protein signal transduction; insulin receptor signaling pathway; toll-like receptor signaling pathway; innate immune response; positive regulation of Ras protein signal transduction; toll-like receptor 9 signaling pathway; response to oxidative stress; cell motility; positive regulation of cell differentiation; vascular endothelial growth factor receptor signaling pathway; positive regulation of cell migration

Disease: Noonan Syndrome 1; Cardiofaciocutaneous Syndrome 3

Research Articles on MAP2K1

Similar Products

Product Notes

The MAP2K1 map2k1 (Catalog #AAA3223197) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAP2K1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAP2K1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAP2K1 map2k1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VEMAVGRYPI PPPDAKELEL MFGCQVEGDA AETPPRPRTP GRPLSSYGMD. It is sometimes possible for the material contained within the vial of "MAP2K1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.