Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human BCR Monoclonal Antibody | anti-BCR antibody

BCR (Breakpoint Cluster Region Protein, Renal Carcinoma Antigen NY-REN-26, BCR1, D22S11) (PE)

Gene Names
BCR; ALL; CML; PHL; BCR1; D22S11; D22S662
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BCR; Monoclonal Antibody; BCR (Breakpoint Cluster Region Protein; Renal Carcinoma Antigen NY-REN-26; BCR1; D22S11) (PE); anti-BCR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E5
Specificity
Recognizes human BCR.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-BCR antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa182-280 from human BCR (NP_004318.3) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQ
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for recombinant GST tagged BCR is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged BCR is ~0.1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between TP53 and BCR. HeLa cells were stained with TP53 rabbit purified polyclonal 1:1200 and BCR mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between TP53 and BCR. HeLa cells were stained with TP53 rabbit purified polyclonal 1:1200 and BCR mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-BCR antibody
GTPase-activating protein for RAC1 and CDC42. Promotes the exchange of RAC or CDC42-bound GDP by GTP, thereby activating them. Displays serine/threonine kinase activity.
Product Categories/Family for anti-BCR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
613
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
142,819 Da
NCBI Official Full Name
breakpoint cluster region protein isoform 1
NCBI Official Synonym Full Names
breakpoint cluster region
NCBI Official Symbol
BCR
NCBI Official Synonym Symbols
ALL; CML; PHL; BCR1; D22S11; D22S662
NCBI Protein Information
breakpoint cluster region protein; BCR/FGFR1 chimera protein; FGFR1/BCR chimera protein; renal carcinoma antigen NY-REN-26
UniProt Protein Name
Breakpoint cluster region protein
UniProt Gene Name
BCR
UniProt Synonym Gene Names
BCR1; D22S11
UniProt Entry Name
BCR_HUMAN

NCBI Description

A reciprocal translocation between chromosomes 22 and 9 produces the Philadelphia chromosome, which is often found in patients with chronic myelogenous leukemia. The chromosome 22 breakpoint for this translocation is located within the BCR gene. The translocation produces a fusion protein which is encoded by sequence from both BCR and ABL, the gene at the chromosome 9 breakpoint. Although the BCR-ABL fusion protein has been extensively studied, the function of the normal BCR gene product is not clear. The protein has serine/threonine kinase activity and is a GTPase-activating protein for p21rac. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Bcr: a protein with serine/threonine protein kinase activity and is a GTPase-activating protein (GAP) for RAC1 and CDC42. The amino-terminal region of Bcr contains an oligomerization domain, a serine/threonine kinase domain and a region that binds SH2 domains. The middle of the protein has a PH domain and a region of sequence similarity to the guanine nucleotide exchange factors for the Rho family of GTP binding proteins. The carboxy-terminal region promotes the exchange of RAC or CDC42-bound GDP by GTP, thereby activating them. A breakpoint cluster region protein that participates in a t(9;22)(q34;q11) chromosomal translocation that produces a BCR-ABL oncogene responsible for chronic myeloid leukemia (CML), acute myeloid leukemia (AML) and acute lymphoblastic leukemia (ALL). The function of wild type Bcr in cells remains unclear. PDGF receptor may use Bcr as a downstream signaling mediator. Tyr177 of human Bcr, phosphorylated in the Bcr-Abl fusion protein, provides a docking site for Gab2 and GRB2, and is important in the transforming activity of Bcr-Abl. Sequence variants of the Bcr protein may be associated with bipolar disorder. Two alternatively spliced isoforms of the human protein have been reported.

Protein type: Kinase, protein; GAPs; GAPs, Rac/Rho; Oncoprotein; GEFs, Rac/Rho; Protein kinase, atypical; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); ATYPICAL group; BCR family

Chromosomal Location of Human Ortholog: 22q11.23

Cellular Component: postsynaptic membrane; protein complex; membrane; postsynaptic density; cytosol; cell junction

Molecular Function: protein serine/threonine kinase activity; Rho guanyl-nucleotide exchange factor activity; protein binding; enzyme binding; protein-tyrosine kinase activity; kinase activity; ATP binding; GTPase activator activity

Biological Process: inner ear morphogenesis; peptidyl-tyrosine phosphorylation; regulation of cell cycle; protein amino acid autophosphorylation; platelet-derived growth factor receptor signaling pathway; response to lipopolysaccharide; signal transduction; protein amino acid phosphorylation; negative regulation of neutrophil degranulation; regulation of small GTPase mediated signal transduction; small GTPase mediated signal transduction; positive regulation of phagocytosis; negative regulation of inflammatory response; brain development; actin cytoskeleton organization and biogenesis; neuromuscular process controlling balance; negative regulation of cell migration

Disease: Leukemia, Acute Lymphoblastic; Leukemia, Chronic Myeloid

Research Articles on BCR

Similar Products

Product Notes

The BCR bcr (Catalog #AAA6156723) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BCR (Breakpoint Cluster Region Protein, Renal Carcinoma Antigen NY-REN-26, BCR1, D22S11) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BCR can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BCR bcr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BCR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.