Mouse anti-Human ATP5E Monoclonal Antibody | anti-ATP5E antibody

ATP5E (ATP Synthase Subunit epsilon, Mitochondrial, ATPase Subunit epsilon) (Biotin)

Cat. Num. AAA6140733

• Gene Names: ATP5F1E; ATPE; ATP5E; MC5DN3
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ATP5E; Monoclonal Antibody; ATP5E (ATP Synthase Subunit epsilon; Mitochondrial; ATPase Subunit epsilon) (Biotin); anti-ATP5E antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2F3
• Specificity: Recognizes human ATP5E.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 414

• Applicable Applications for anti-ATP5E antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-51 from human ATP5E (AAH01690) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (31.35kD).)

Western Blot (WB)

(ATP5E monoclonal antibody Western Blot analysis of ATP5E expression in SW-13.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ATP5E on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml].)

Product Categories/Family for anti-ATP5E antibody

Antibodies; Enzymes; ATPase

References

1. Assessing the actual contribution of IF1, an inhibitor of mitochondrial FoF1, to ATP homeostasis, cell growth, mitochondrial morphology and cell viability. Fujikawa M, Imamura H, Nakamura J, Yoshida M.J Biol Chem. 2012 Apr 9. 2. Mitochondrial ATP synthase deficiency due to a mutation in the ATP5E gene for the F1 {varepsilon} subunit. Mayr JA, Havlickova V, Zimmermann F, Magler I, Kaplanova V, Jesina P, Pecinova A, Nuskova H, Koch J, Sperl W, Houstek J.Hum Mol Genet. 2010 Jul 1. 3. Knockdown of F(1) epsilon subunit decreases mitochondrial content of ATP synthase and leads to accumulation of subunit c. Havlickova V, Kaplanova V, Nuskova H, Drahota Z, Houstek J.Biochim Biophys Acta. 2009 Dec 21.

NCBI and Uniprot Product Information

• NCBI GI #: 12804554
• NCBI GeneID: 514
• NCBI Official Full Name: Homo sapiens ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit, mRNA
• NCBI Official Synonym Full Names: ATP synthase F1 subunit epsilon
• NCBI Official Symbol: ATP5F1E
• NCBI Official Synonym Symbols: ATPE; ATP5E; MC5DN3
• NCBI Protein Information: ATP synthase subunit epsilon, mitochondrial

NCBI Description

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the epsilon subunit of the catalytic core. Two pseudogenes of this gene are located on chromosomes 4 and 13. Read-through transcripts that include exons from this gene are expressed from the upstream gene SLMO2.[provided by RefSeq, Mar 2011]