Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (31.35kD).)

Mouse anti-Human ATP5E Monoclonal Antibody | anti-ATP5E antibody

ATP5E (ATP Synthase Subunit epsilon, Mitochondrial, ATPase Subunit epsilon) APC

Gene Names
ATP5F1E; ATPE; ATP5E; MC5DN3
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATP5E; Monoclonal Antibody; ATP5E (ATP Synthase Subunit epsilon; Mitochondrial; ATPase Subunit epsilon) APC; anti-ATP5E antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F3
Specificity
Recognizes human ATP5E.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
414
Applicable Applications for anti-ATP5E antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-51 from human ATP5E (AAH01690) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (31.35kD).)

Western Blot (WB) (Western Blot detection against Immunogen (31.35kD).)

Western Blot (WB)

(ATP5E monoclonal antibody Western Blot analysis of ATP5E expression in SW-13.)

Western Blot (WB) (ATP5E monoclonal antibody Western Blot analysis of ATP5E expression in SW-13.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ATP5E on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ATP5E on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml].)
Product Categories/Family for anti-ATP5E antibody
References
1. Assessing the actual contribution of IF1, an inhibitor of mitochondrial FoF1, to ATP homeostasis, cell growth, mitochondrial morphology and cell viability. Fujikawa M, Imamura H, Nakamura J, Yoshida M.J Biol Chem. 2012 Apr 9. 2. Mitochondrial ATP synthase deficiency due to a mutation in the ATP5E gene for the F1 {varepsilon} subunit. Mayr JA, Havlickova V, Zimmermann F, Magler I, Kaplanova V, Jesina P, Pecinova A, Nuskova H, Koch J, Sperl W, Houstek J.Hum Mol Genet. 2010 Jul 1. 3. Knockdown of F(1) epsilon subunit decreases mitochondrial content of ATP synthase and leads to accumulation of subunit c. Havlickova V, Kaplanova V, Nuskova H, Drahota Z, Houstek J.Biochim Biophys Acta. 2009 Dec 21.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
514
NCBI Official Full Name
Homo sapiens ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit, mRNA
NCBI Official Synonym Full Names
ATP synthase F1 subunit epsilon
NCBI Official Symbol
ATP5F1E
NCBI Official Synonym Symbols
ATPE; ATP5E; MC5DN3
NCBI Protein Information
ATP synthase subunit epsilon, mitochondrial

NCBI Description

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the epsilon subunit of the catalytic core. Two pseudogenes of this gene are located on chromosomes 4 and 13. Read-through transcripts that include exons from this gene are expressed from the upstream gene SLMO2.[provided by RefSeq, Mar 2011]

Research Articles on ATP5E

Similar Products

Product Notes

The ATP5E (Catalog #AAA6135430) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATP5E (ATP Synthase Subunit epsilon, Mitochondrial, ATPase Subunit epsilon) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP5E can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP5E for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP5E, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.