Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: L3HYPDHSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human L3HYPDH Polyclonal Antibody | anti-L3HYPDH antibody

L3HYPDH Antibody - C-terminal region

Gene Names
L3HYPDH; C14orf149
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
L3HYPDH; Polyclonal Antibody; L3HYPDH Antibody - C-terminal region; anti-L3HYPDH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GTILTDGKDAYTKEPTTNICVFADEQVDRSPTGSGVTARIALQYHKGLLE
Sequence Length
354
Applicable Applications for anti-L3HYPDH antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human L3HYPDH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: L3HYPDHSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: L3HYPDHSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-L3HYPDH antibody
This is a rabbit polyclonal antibody against L3HYPDH. It was validated on Western Blot

Target Description: L3HYPDH catalyzes the dehydration of trans-3-hydroxy-L-proline to delta-1-pyrroline-2-carboxylate (Pyr2C). It may be required to degrade trans-3-hydroxy-L-proline from the diet and originating from the degradation of proteins such as collagen-IV that contain it.
Product Categories/Family for anti-L3HYPDH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
trans-3-hydroxy-L-proline dehydratase isoform a
NCBI Official Synonym Full Names
trans-L-3-hydroxyproline dehydratase
NCBI Official Symbol
L3HYPDH
NCBI Official Synonym Symbols
C14orf149
NCBI Protein Information
trans-3-hydroxy-L-proline dehydratase
UniProt Protein Name
Trans-L-3-hydroxyproline dehydratase
UniProt Gene Name
L3HYPDH
UniProt Synonym Gene Names
C14orf149
UniProt Entry Name
T3HPD_HUMAN

NCBI Description

The protein encoded by this gene is a dehydratase that converts trans-3-hydroxy-L-proline to delta(1)-pyrroline-2-carboxylate. This enzyme may function to degrade dietary proteins that contain trans-3-hydroxy-L-proline as well as other proteins such as collagen IV. The encoded protein can be converted to an epimerase by changing a threonine to a cysteine at a catalytic site. [provided by RefSeq, Sep 2016]

Uniprot Description

L3HYPDH: Catalyzes the dehydration of trans-3-hydroxy-L-proline to delta-1-pyrroline-2-carboxylate (Pyr2C). May be required to degrade trans-3-hydroxy-L-proline from the diet and originating from the degradation of proteins such as collagen-IV that contain it. Belongs to the proline racemase family.

Protein type: EC 4.2.1.77; Isomerase

Chromosomal Location of Human Ortholog: 14q23.1

Molecular Function: trans-L-3-hydroxyproline dehydratase activity; proline racemase activity; hydro-lyase activity

Biological Process: metabolic process

Research Articles on L3HYPDH

Similar Products

Product Notes

The L3HYPDH l3hypdh (Catalog #AAA3218108) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The L3HYPDH Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's L3HYPDH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the L3HYPDH l3hypdh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GTILTDGKDA YTKEPTTNIC VFADEQVDRS PTGSGVTARI ALQYHKGLLE. It is sometimes possible for the material contained within the vial of "L3HYPDH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.