Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human FAF1 Monoclonal Antibody | anti-FAF1 antibody

FAF1 (FAS-associated Factor 1, hFAF1, UBX Domain-containing Protein 12, UBX Domain-containing Protein 3A, UBXD12, UBXN3A, CGI-03, FLJ37524) (Biotin)

Gene Names
FAF1; hFAF1; CGI-03; HFAF1s; UBXD12; UBXN3A
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FAF1; Monoclonal Antibody; FAF1 (FAS-associated Factor 1; hFAF1; UBX Domain-containing Protein 12; UBX Domain-containing Protein 3A; UBXD12; UBXN3A; CGI-03; FLJ37524) (Biotin); anti-FAF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A10
Specificity
Recognizes human FAF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-FAF1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 30ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa551-651 from human FAF1 (NP_008982) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(FAF1 monoclonal antibody Western Blot analysis of FAF1 expression in HeLa.)

Western Blot (WB) (FAF1 monoclonal antibody Western Blot analysis of FAF1 expression in HeLa.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FAF1 on HeLa cell. [antibody concentration 30ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FAF1 on HeLa cell. [antibody concentration 30ug/ml])
Product Categories/Family for anti-FAF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56,934 Da
NCBI Official Full Name
FAS-associated factor 1
NCBI Official Synonym Full Names
Fas (TNFRSF6) associated factor 1
NCBI Official Symbol
FAF1
NCBI Official Synonym Symbols
hFAF1; CGI-03; HFAF1s; UBXD12; UBXN3A
NCBI Protein Information
FAS-associated factor 1; UBX domain protein 3A; TNFRSF6-associated factor 1; UBX domain-containing protein 12; UBX domain-containing protein 3A
UniProt Protein Name
FAS-associated factor 1
Protein Family
UniProt Gene Name
FAF1
UniProt Synonym Gene Names
UBXD12; UBXN3A; hFAF1
UniProt Entry Name
FAF1_HUMAN

NCBI Description

Interaction of Fas ligand (TNFSF6) with the FAS antigen (TNFRSF6) mediates programmed cell death, also called apoptosis, in a number of organ systems. The protein encoded by this gene binds to FAS antigen and can initiate apoptosis or enhance apoptosis initiated through FAS antigen. Initiation of apoptosis by the protein encoded by this gene requires a ubiquitin-like domain but not the FAS-binding domain. [provided by RefSeq, Jul 2008]

Uniprot Description

FAF1: a pro-apoptotic protein that binds to FAS antigen. Potentiates but cannot initiate FAS-induced apoptosis. Its pro-apoptotic activity requires a ubiquitin-like domain but not the FAS-binding domain. Phosphorylation by protein kinase CK2 influences transport into nucleus. Two transcript variants encoding different protein isoforms have been described.

Protein type: Apoptosis; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 1p33

Cellular Component: perinuclear region of cytoplasm; CD95 death-inducing signaling complex; nuclear envelope; nucleus; cytosol

Molecular Function: NF-kappaB binding; protein domain specific binding; protein binding; ubiquitin binding; ubiquitin protein ligase binding; heat shock protein binding; protein kinase regulator activity; protein kinase binding

Biological Process: regulation of cell adhesion; cell death; proteasomal ubiquitin-dependent protein catabolic process; positive regulation of protein complex assembly; cytoplasmic sequestering of NF-kappaB; positive regulation of apoptosis; apoptosis; regulation of protein catabolic process; regulation of protein kinase activity

Research Articles on FAF1

Similar Products

Product Notes

The FAF1 faf1 (Catalog #AAA6141826) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FAF1 (FAS-associated Factor 1, hFAF1, UBX Domain-containing Protein 12, UBX Domain-containing Protein 3A, UBXD12, UBXN3A, CGI-03, FLJ37524) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FAF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 30ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FAF1 faf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FAF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.