Mouse ATP2B4 Monoclonal Antibody | anti-ATP2B4 antibody

ATP2B4 (ATPase, Ca++ Transporting, Plasma Membrane 4, ATP2B2, DKFZp686G08106, DKFZp686M088, MXRA1, PMCA4, PMCA4b, PMCA4x) (AP)

Cat. Num. AAA6165381

• Gene Names: ATP2B4; MXRA1; PMCA4; ATP2B2; PMCA4b; PMCA4x
• Applications: Western Blot
• Purity: Purified
• Synonyms: ATP2B4; Monoclonal Antibody; ATP2B4 (ATPase; Ca++ Transporting; Plasma Membrane 4; ATP2B2; DKFZp686G08106; DKFZp686M088; MXRA1; PMCA4; PMCA4b; PMCA4x) (AP); ATPase; PMCA4x; anti-ATP2B4 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2G8
• Specificity: Recognizes ATP2B4.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 1205

• Applicable Applications for anti-ATP2B4 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ATP2B4 (NP_001675, 1aa-92aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKT
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ATP2B4 is 1 ng/ml as a capture antibody.)

Related Product Information for anti-ATP2B4 antibody

The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes the plasma membrane calcium ATPase isoform 4. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Product Categories/Family for anti-ATP2B4 antibody

Antibodies; Enzymes; ATPase

NCBI and Uniprot Product Information

• NCBI GI #: 48255957
• NCBI GeneID: 493
• NCBI Accession #: NP_001675
• NCBI GenBank Nucleotide #: NP_001675.3
• UniProt Accession #: P23634
• NCBI Official Full Name: plasma membrane calcium-transporting ATPase 4 isoform 4b
• NCBI Official Synonym Full Names: ATPase plasma membrane Ca2+ transporting 4
• NCBI Official Symbol: ATP2B4
• NCBI Official Synonym Symbols: MXRA1; PMCA4; ATP2B2; PMCA4b; PMCA4x
• NCBI Protein Information: plasma membrane calcium-transporting ATPase 4
• UniProt Protein Name: Plasma membrane calcium-transporting ATPase 4
• Protein Family: Plasma membrane calcium-transporting ATPase
• UniProt Gene Name: ATP2B4
• UniProt Synonym Gene Names: PMCA4

NCBI Description

The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes the plasma membrane calcium ATPase isoform 4. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

PMCA4: a plasma membrane calcium pump. A magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell. Eight splice-variant isoforms have been described.

Protein type: Channel, calcium; EC 3.6.3.8; Hydrolase; Membrane protein, integral; Membrane protein, multi-pass; Transporter; Transporter, ion channel

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: basolateral plasma membrane; caveola; integral component of plasma membrane; intracellular membrane-bound organelle; membrane; neuron projection; plasma membrane; protein complex; T-tubule; Z disc

Molecular Function: ATP binding; calcium-transporting ATPase activity; calmodulin binding; metal ion binding; nitric-oxide synthase binding; nitric-oxide synthase inhibitor activity; PDZ domain binding; protein binding; protein kinase binding; protein phosphatase 2B binding; sodium channel regulator activity

Biological Process: calcium ion export; calcium ion import across plasma membrane; cellular calcium ion homeostasis; cellular response to epinephrine stimulus; hippocampus development; negative regulation of adrenergic receptor signaling pathway involved in heart process; negative regulation of arginine catabolic process; negative regulation of nitric oxide biosynthetic process; negative regulation of nitric oxide mediated signal transduction; negative regulation of nitric-oxide synthase activity; negative regulation of peptidyl-cysteine S-nitrosylation; negative regulation of the force of heart contraction; neural retina development; positive regulation of cAMP-dependent protein kinase activity; positive regulation of peptidyl-serine phosphorylation; regulation of cell cycle G1/S phase transition; regulation of sodium ion transmembrane transport; regulation of transcription from RNA polymerase II promoter; response to hydrostatic pressure; sperm motility; spermatogenesis