Mouse anti-Human ATF6B Monoclonal Antibody | anti-ATF6B antibody

ATF6B (Cyclic AMP-dependent Transcription Factor ATF-6 beta, cAMP-dependent Transcription Factor ATF-6 beta, Activating Transcription Factor 6 beta, ATF6-beta, Protein G13, cAMP Response Element-binding Protein-related Protein, Creb-rp, cAMP-responsive El

Cat. Num. AAA6130112

• Gene Names: ATF6B; G13; CREBL1; CREB-RP
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ATF6B; Monoclonal Antibody; ATF6B (Cyclic AMP-dependent Transcription Factor ATF-6 beta; cAMP-dependent Transcription Factor ATF-6 beta; Activating Transcription Factor 6 beta; ATF6-beta; Protein G13; cAMP Response Element-binding Protein-related Protein; Creb-rp; cAMP-responsive El; anti-ATF6B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4D10
• Specificity: Recognizes human CREBL1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-ATF6B antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa2-88 from human CREBL1 (NP_004372.3) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLPIFPDLQVK
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.31kD).)

Testing Data

(Detection limit for recombinant GST tagged CREBL1 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-ATF6B antibody

Transcriptional factor that acts in the unfolded protein response (UPR) pathway by activating UPR target genes induced during ER stress. Binds DNA on the 5'-CCAC[GA]-3' half of the ER stress response element (ERSE) (5'-CCAATN9CCAC[GA]-3') when NF-Y is bound to ERSE.

Product Categories/Family for anti-ATF6B antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 20631977
• NCBI GeneID: 1388
• NCBI Accession #: NP_004372.3
• NCBI GenBank Nucleotide #: NM_004381
• Molecular Weight: 76,412 Da
• NCBI Official Full Name: cyclic AMP-dependent transcription factor ATF-6 beta isoform a
• NCBI Official Synonym Full Names: activating transcription factor 6 beta
• NCBI Official Symbol: ATF6B
• NCBI Official Synonym Symbols: G13; CREBL1; CREB-RP
• NCBI Protein Information: cyclic AMP-dependent transcription factor ATF-6 beta; protein G13; Creb-related protein; cAMP responsive element binding protein-like 1; cAMP-dependent transcription factor ATF-6 beta; cAMP-responsive element-binding protein-like 1; cAMP response element-
• Protein Family: Cyclic AMP-dependent transcription factor

NCBI Description

The protein encoded by this gene is a transcription factor in the unfolded protein response (UPR) pathway during ER stress. Either as a homodimer or as a heterodimer with ATF6-alpha, the encoded protein binds to the ER stress response element, interacting with nuclear transcription factor Y to activate UPR target genes. The protein is normally found in the membrane of the endoplasmic reticulum; however, under ER stress, the N-terminal cytoplasmic domain is cleaved from the rest of the protein and translocates to the nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]