Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Mouse anti-Human ASB11 Monoclonal Antibody | anti-ASB11 antibody
ASB11 (Ankyrin Repeat and SOCS Box Protein 11, ASB-11, DKFZp779E2460, MGC119168, MGC119169) APC
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ASB11; Monoclonal Antibody; ASB11 (Ankyrin Repeat and SOCS Box Protein 11; ASB-11; DKFZp779E2460; MGC119168; MGC119169) APC; anti-ASB11 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D11
Specificity
Recognizes human ASB11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
323
Applicable Applications for anti-ASB11 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa214-324 from human ASB11 (NP_543149) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KLLELGASVDHGQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLGRACHQAIHKLHLPEPLERFLLYQ
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Testing Data
(Detection limit for recombinant GST tagged ASB11 is ~1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ASB11 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-ASB11 antibody
May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Product Categories/Family for anti-ASB11 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ankyrin repeat and SOCS box protein 11 isoform a
NCBI Official Synonym Full Names
ankyrin repeat and SOCS box containing 11
NCBI Official Symbol
ASB11
NCBI Protein Information
ankyrin repeat and SOCS box protein 11
UniProt Protein Name
Ankyrin repeat and SOCS box protein 11
Protein Family
UniProt Gene Name
ASB11
UniProt Synonym Gene Names
ASB-11
UniProt Entry Name
ASB11_HUMAN
NCBI Description
The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011]
Uniprot Description
Function: May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins
Research Articles on ASB11
Similar Products
Product Notes
The ASB11 asb11 (Catalog #AAA6135389) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ASB11 (Ankyrin Repeat and SOCS Box Protein 11, ASB-11, DKFZp779E2460, MGC119168, MGC119169) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ASB11 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ASB11 asb11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ASB11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
