Mouse ARRB2 Monoclonal Antibody | anti-ARRB2 antibody

ARRB2 (Arrestin, beta 2, ARB2, ARR2, BARR2, DKFZp686L0365) (PE)

Cat. Num. AAA6185664

• Gene Names: ARRB2; ARB2; ARR2; BARR2
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: ARRB2; Monoclonal Antibody; ARRB2 (Arrestin; beta 2; ARB2; ARR2; BARR2; DKFZp686L0365) (PE); Arrestin; DKFZp686L0365; anti-ARRB2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4D2
• Specificity: Recognizes ARRB2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 409

• Applicable Applications for anti-ARRB2 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ARRB2 (AAH07427, 300aa-409aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ARRB2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ARRB2 on HeLa cell. [antibody concentration 10 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged ARRB2 is approximately 0.3ng/ml as a capture antibody.)

Western Blot (WB)

(ARRB2 monoclonal antibody (M06), clone 4D2. Western Blot analysis of ARRB2 expression in MCF-7.)

Western Blot (WB)

(ARRB2 monoclonal antibody (M06), clone 4D2. Western Blot analysis of ARRB2 expression in PC-12.)

Related Product Information for anti-ARRB2 antibody

Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. [provided by RefSeq]

Product Categories/Family for anti-ARRB2 antibody

Antibodies; Arrestin

NCBI and Uniprot Product Information

• NCBI GI #: 13938555
• NCBI GeneID: 409
• NCBI Official Full Name: Arrestin, beta 2
• NCBI Official Synonym Full Names: arrestin beta 2
• NCBI Official Symbol: ARRB2
• NCBI Official Synonym Symbols: ARB2; ARR2; BARR2
• NCBI Protein Information: beta-arrestin-2
• Protein Family: Beta-arrestin

NCBI Description

Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2012]