Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ARMET Monoclonal Antibody | anti-ARMET antibody

ARMET (Arginine-rich Mutated in Early Stage Tumors, Arginine-rich Protein, ARP, Mesencephalic Astrocyte-derived Neurotrophic Factor, MANF, MGC142148, MGC142150) (MaxLight 550)

Gene Names
MANF; ARP; ARMET
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARMET; Monoclonal Antibody; ARMET (Arginine-rich Mutated in Early Stage Tumors; Arginine-rich Protein; ARP; Mesencephalic Astrocyte-derived Neurotrophic Factor; MANF; MGC142148; MGC142150) (MaxLight 550); anti-ARMET antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D10
Specificity
Recognizes human ARMET.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-ARMET antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa116-186 from ARMET (NP_006001) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL*
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ARMET antibody
Armet encodes a highly conserved protein whose function is not yet known. The protein was initially thought to be longer at the N-terminus and to contain an arginine-rich region but transcribed evidence indicates a smaller open reading frame that does not encode the arginine tract. The presence of a specific mutation changing the previously numbered codon 50 from ATG to AGG, or deletion of that codon, has been reported in a variety of solid tumors.
Product Categories/Family for anti-ARMET antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,700 Da
NCBI Official Full Name
mesencephalic astrocyte-derived neurotrophic factor
NCBI Official Synonym Full Names
mesencephalic astrocyte-derived neurotrophic factor
NCBI Official Symbol
MANF
NCBI Official Synonym Symbols
ARP; ARMET
NCBI Protein Information
mesencephalic astrocyte-derived neurotrophic factor; arginine-rich, mutated in early stage tumors
UniProt Protein Name
Mesencephalic astrocyte-derived neurotrophic factor
UniProt Gene Name
MANF
UniProt Synonym Gene Names
ARMET; ARP
UniProt Entry Name
MANF_HUMAN

NCBI Description

The protein encoded by this gene is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted. Reducing expression of this gene increases susceptibility to ER stress-induced death and results in cell proliferation. Activity of this protein is important in promoting the survival of dopaminergic neurons. The presence of polymorphisms in the N-terminal arginine-rich region, including a specific mutation that changes an ATG start codon to AGG, have been reported in a variety of solid tumors; however, these polymorphisms were later shown to exist in normal tissues and are thus no longer thought to be tumor-related. [provided by RefSeq, Apr 2014]

Uniprot Description

ARMET: Selectively promotes the survival of dopaminergic neurons of the ventral mid-brain. Modulates GABAergic transmission to the dopaminergic neurons of the substantia nigra. Enhances spontaneous, as well as evoked, GABAergic inhibitory postsynaptic currents in dopaminergic neurons. Inhibits cell proliferation and endoplasmic reticulum (ER) stress-induced cell death. Belongs to the ARMET family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 3p21.1

Cellular Component: extracellular space; perinuclear region of cytoplasm; endoplasmic reticulum; nucleus

Molecular Function: growth factor activity

Biological Process: vasoconstriction of artery involved in ischemic response to lowering of systemic arterial blood pressure; response to unfolded protein

Disease: Pancreatic Cancer

Research Articles on ARMET

Similar Products

Product Notes

The ARMET manf (Catalog #AAA6210282) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARMET (Arginine-rich Mutated in Early Stage Tumors, Arginine-rich Protein, ARP, Mesencephalic Astrocyte-derived Neurotrophic Factor, MANF, MGC142148, MGC142150) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARMET can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARMET manf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARMET, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.