Western Blot (WB)
(Western Blot detection against Immunogen (40.8kD).)
Mouse anti-Human ARL9 Monoclonal Antibody
ARL9 (ADP-ribosylation Factor-like Protein 9)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
AscitesAscites
Synonyms
ARL9; Monoclonal Antibody; ARL9 (ADP-ribosylation Factor-like Protein 9); Anti -ARL9 (ADP-ribosylation Factor-like Protein 9); anti-ARL9 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgM,k
Clone Number
7A2
Specificity
Recognizes human ARL9.
Purity/Purification
Ascites
Ascites
Ascites
Form/Format
Supplied as a liquid in ascites fluid.
Sequence
MEFLEIGGSKPFRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPVLPLVVFANKQDLEAAYHITDIHEALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIAQLAADVQ
Applicable Applications for anti-ARL9 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full length recombinant protein corresponding to aa1-123 from human ARL9 (NP_996802.1) with GST tag.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (40.8kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (40.8kD).)
Western Blot (WB)
(Western Blot analysis of ARL9 expression in transfected 293T cell line by ARL9 monoclonal antibody.|Lane 1: ARL9 transfected lysate (13.8kD).|Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of ARL9 expression in transfected 293T cell line by ARL9 monoclonal antibody.|Lane 1: ARL9 transfected lysate (13.8kD).|Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-ARL9 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Official Full Name
ADP-ribosylation factor-like 9
Protein Family
Uniprot Description
ARL9: Belongs to the small GTPase superfamily. Arf family
Protein type: G protein, monomeric; G protein, monomeric, ARF
Chromosomal Location of Human Ortholog: 4q12
Cellular Component: intracellular
Molecular Function: GTP binding
Biological Process: small GTPase mediated signal transduction
Similar Products
Product Notes
The ARL9 (Catalog #AAA646434) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARL9 (ADP-ribosylation Factor-like Protein 9) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARL9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the ARL9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEFLEIGGSK PFRSYWEMYL SKGLLLIFVV DSADHSRLPE AKKYLHQLIA ANPVLPLVVF ANKQDLEAAY HITDIHEALA LSEVGNDRKM FLFGTYLTKN GSEIPSTMQD AKDLIAQLAA DVQ. It is sometimes possible for the material contained within the vial of "ARL9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
